Gene Card
Gene overview
cDNA / CDS / Protein Sequences
900 bp · LXL04_006722|LXL04_006722|OH1004|cDNA
ATGAGTTTGAATTTATTGAACCGTGGTAGATCAAGGAATGCTTCATCAATATGCCTTGTTGACTTTTCTTTTGGTGGTGATCATTTGTTGGACAGATTTAGCGTTTTTGTTTTATTTAGTGTTGGTTCTGTTTACATCCTATGTCCAGTTGTTCATTTCGAAAGtGTCTACAAATGGGAGTCTGTATTGGAGATATACACAGATGCTCAAACTTTTGGACTTAAAGCTGCAAGCTCCAAAGCTGTCAGTAATGCCAGCCT...
900 bp · LXL04_006722|LXL04_006722|OH1004|CDS
ATGAGTTTGAATTTATTGAACCGTGGTAGATCAAGGAATGCTTCATCAATATGCCTTGTTGACTTTTCTTTTGGTGGTGATCATTTGTTGGACAGATTTAGCGTTTTTGTTTTATTTAGTGTTGGTTCTGTTTACATCCTATGTCCAGTTGTTCATTTCGAAAGTGTCTACAAATGGGAGTCTGTATTGGAGATATACACAGATGCTCAAACTTTTGGACTTAAAGCTGCAAGCTCCAAAGCTGTCAGTAATGCCAGCCT...
Protein
Download Protein FASTA299 aa · LXL04_006722|LXL04_006722|OH1004|PROTEIN
MSLNLLNRGRSRNASSICLVDFSFGGDHLLDRFSVFVLFSVGSVYILCPVVHFESVYKWESVLEIYTDAQTFGLKAASSKAVSNASLAISWLEATFPDLAEQATEGILYYPHSPCTKIQPVWTPGNHPRLSVNPQDRITGVAIICEPQSTDLSVDHNTWLGNSPPLLKLGAVDLALPGKQDSRSLISMCIDPLIPERIYTIHDGGVDSIVLHFLPFTNQKNGKDDDDDVRAPSAQSVMSTWQVESRVAPLCGFVAVSDSF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_006722 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_006722 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr02:23163447-23164718 (-) | ||||||
| Description | Similar to NUP88: Nuclear pore complex protein NUP88 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000055 ribosomal large subunit export from nucleus Biological Process GO:0000056 ribosomal small subunit export from nucleus Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006611 protein export from nucleus Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0045087 innate immune response Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0017056 structural constituent of nuclear pore Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT5G05680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FFK6 | Arabidopsis thaliana | Nuclear pore complex protein NUP88 | 51.351% | Swiss-Prot | moderate database homology |