LXL04_006708 | RubberDandelionOmics

Gene overview

LXL04_006708

Reference: OH-1004 Chr: Chr02 Coordinates: 22665931-22669612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3534 bp · LXL04_006708|LXL04_006708|OH1004|cDNA

ATGGAGAAGCGACTTCGTTCGTCACTGAAATCATCGGCCGACGAATTCCTCTCATCGGCGGCGAAATTAGGGTATTCTTCTGTAAAAGCATCTCTCAAAACCCTAATTTACTCTCTAAAGCCATCATCTGATGTCGTTTCTTCACTACCTCTTTCTCTTCACCATTCCATTTCTCAATCCATCACTCGGTTTAAAGATCTGTCGGGAAACAATGGCACAGGAGGTACATCTTCCGTCGGTGCTACCTCACCTGTTACGCC...

CDS

Download CDS FASTA

3534 bp · LXL04_006708|LXL04_006708|OH1004|CDS

ATGGAGAAGCGACTTCGTTCGTCACTGAAATCATCGGCCGACGAATTCCTCTCATCGGCGGCGAAATTAGGGTATTCTTCTGTAAAAGCATCTCTCAAAACCCTAATTTACTCTCTAAAGCCATCATCTGATGTCGTTTCTTCACTACCTCTTTCTCTTCACCATTCCATTTCTCAATCCATCACTCGGTTTAAAGATCTGTCGGGAAACAATGGCACAGGAGGTACATCTTCCGTCGGTGCTACCTCACCTGTTACGCC...

Protein

Download Protein FASTA

1177 aa · LXL04_006708|LXL04_006708|OH1004|PROTEIN

MEKRLRSSLKSSADEFLSSAAKLGYSSVKASLKTLIYSLKPSSDVVSSLPLSLHHSISQSITRFKDLSGNNGTGGTSSVGATSPVTPASKRVRRSSRRPESDTTNGKDDPSGTVDQKLKVEKVKSEVTENLQIYAHVAYLCVTHPGGMFSASDLLPAVQELHDNLVVFELESNLLSDIASICEEWWKRELPCRDSLISQSLPFLVSKSLTLKKKVNVHRVYALREAFTMFDFEDESIEDLKLLLIRCLISPLYLKMDEGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006708`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_006708`
Location	Chr02:22665931-22669612 (-)
Description	Similar to ncapg2: Condensin-2 complex subunit G2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006708` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000070 mitotic sister chromatid segregation Biological Process GO:0007076 mitotic chromosome condensation Biological Process GO:0030261 chromosome condensation Biological Process GO:0051301 cell division Biological Process GO:0051984 positive regulation of chromosome segregation Biological Process GO:1905820 positive regulation of chromosome separation Biological Process GO:1905821 positive regulation of chromosome condensation Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0000796 condensin complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	dre:100037337 hsa:54892 mmu:76044 xla:446284 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · LXL04_006708 · OH-1004

Cytoplasm0.142

Rank 2 · LXL04_006708 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_006708 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_006708 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_006708 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12422.14Condensin2nSMC246-394 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006708	`PF12422.14`	Condensin2nSMC	246	394	3.9e-57	193.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card