LXL04_006557 | RubberDandelionOmics

Gene overview

LXL04_006557

Reference: OH-1004 Chr: Chr02 Coordinates: 13414884-13416549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_006557|LXL04_006557|OH1004|cDNA

ATGATCATAACAAAACAATACCGATGCATACACTCGGCGACCTGCATCTGCACAAAAGGCCATCTAAGCGAAGACGTAATCTTCCTTCTTCTCCAACACCTAAACTGGAACCCCAAAATCATCGCGACCCTCTCATGCGTCTGCAAATGGTTCGACGACCTAGTAAAAAGAATCCTCTGGAAAGAATTCTGCAGAACACGCGCCCCCAAAATGATGCACGACCTCCAATCAAGCGGGTCCCACAGTGTAGACGGCAACTG...

CDS

Download CDS FASTA

645 bp · LXL04_006557|LXL04_006557|OH1004|CDS

ATGATCATAACAAAACAATACCGATGCATACACTCGGCGACCTGCATCTGCACAAAAGGCCATCTAAGCGAAGACGTAATCTTCCTTCTTCTCCAACACCTAAACTGGAACCCCAAAATCATCGCGACCCTCTCATGCGTCTGCAAATGGTTCGACGACCTAGTAAAAAGAATCCTCTGGAAAGAATTCTGCAGAACACGCGCCCCCAAAATGATGCACGACCTCCAATCAAGCGGGTCCCACAGTGTAGACGGCAACTG...

Protein

Download Protein FASTA

214 aa · LXL04_006557|LXL04_006557|OH1004|PROTEIN

MIITKQYRCIHSATCICTKGHLSEDVIFLLLQHLNWNPKIIATLSCVCKWFDDLVKRILWKEFCRTRAPKMMHDLQSSGSHSVDGNWSSLGKLLIYCSGCKKDGLFNKIQIPGHFAYRTRFSRTSGKSFLLPNCRTDVLYVSDPCEHLDQGEEGDVGFFRGVFKSFANTKVRKMLIRKEAKFHESEVCPYCKAKLWRGVRIGLRGTGIVRWGIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006557`
TK1151 ID	TkA03G048120
OH-1004 ID	LXL04_006557
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.500
Protein coverage (%)	TK1151 78.400 / OH-1004 91.589 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006557

Location Chr02:13414884-13416549 (+)

Description Similar to EDL2: EID1-like F-box protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39360`	EID1-like F-box protein 2.	No verified direct reference in this release
`At5g15440`	EID1-like F-box protein 1.	No verified direct reference in this release
`At3g63060`	EID1-like F-box protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006557 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G63060

ath:AT5G15440

ath:AT5G39360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.639

Rank 1 · LXL04_006557 · OH-1004

Cytoplasm0.263

Rank 2 · LXL04_006557 · OH-1004

Cell membrane0.068

Rank 3 · LXL04_006557 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_006557 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_006557 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27778.1EID2_C110-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006557	`PF27778.1`	EID2_C	110	196	6.1e-35	120.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLZ8`	Arabidopsis thaliana	EID1-like F-box protein 2	79.188%	Swiss-Prot	strong database homology
`Q9LF38`	Arabidopsis thaliana	EID1-like F-box protein 1	75.127%	Swiss-Prot	strong database homology
`Q93ZT5`	Arabidopsis thaliana	EID1-like F-box protein 3	40.341%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card