LXL04_006531 | RubberDandelionOmics

Gene overview

LXL04_006531

Reference: OH-1004 Chr: Chr02 Coordinates: 13025329-13030021 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · LXL04_006531|LXL04_006531|OH1004|cDNA

ATGCACCCCCCCACACCCAACCCCAACCCTACCCTACCCCCTACCCCTTCTCTTTCTAACTTCTTCTCTGAAGAAACCAAGCTCCTTGCAATATCCATGGCCAAATTACGTAATTCTCCCACATTTTTTCGACTCACTTTCTTGTTTCTTGCTTTTCAACTCACCACAAGTGACAAAAATACCCTTCACAACAACCACCATCTCCATCTTCATGAGGAAGAAGCTGACCGGATCACAGCCCTTCCCGGCCAACCCAACGT...

CDS

Download CDS FASTA

1533 bp · LXL04_006531|LXL04_006531|OH1004|CDS

ATGCACCCCCCCACACCCAACCCCAACCCTACCCTACCCCCTACCCCTTCTCTTTCTAACTTCTTCTCTGAAGAAACCAAGCTCCTTGCAATATCCATGGCCAAATTACGTAATTCTCCCACATTTTTTCGACTCACTTTCTTGTTTCTTGCTTTTCAACTCACCACAAGTGACAAAAATACCCTTCACAACAACCACCATCTCCATCTTCATGAGGAAGAAGCTGACCGGATCACAGCCCTTCCCGGCCAACCCAACGT...

Protein

Download Protein FASTA

510 aa · LXL04_006531|LXL04_006531|OH1004|PROTEIN

MHPPTPNPNPTLPPTPSLSNFFSEETKLLAISMAKLRNSPTFFRLTFLFLAFQLTTSDKNTLHNNHHLHLHEEEADRITALPGQPNVSFHQFSGYVTVNKVAGRALFYWLTETADHPLSKPLVIWLNGGPGCSSVAYGASEEVGPFRINKGATGLHVNKFSWNNVANILFLETPAGVGFSYSNRSSDLLDTGDRRTAEDSLQFVIRWMERFPRYKKREVYISGESYAGHYVPQLARQILRYNFKAGSSSINLKGIMVGNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006531`
TK1151 ID	TkA03G046520
OH-1004 ID	LXL04_006531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006531

Location Chr02:13025329-13030021 (+)

Description Similar to SCPL25: Serine carboxypeptidase-like 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02110`	Probable carboxypeptidase.	No verified direct reference in this release
`At4g30610`	Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups.	BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.091065998 Arabidopsis BRS1 is a secreted and active serine carboxypeptidase.2005 · DOI: 10.1074/jbc.m503299200
`At2g24010`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g24000`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g07990`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006531 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24000

ath:AT2G24010

ath:AT3G02110

ath:AT3G07990

ath:AT4G30610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.375

Rank 1 · LXL04_006531 · OH-1004

Extracellular0.304

Rank 2 · LXL04_006531 · OH-1004

Endoplasmic reticulum0.088

Rank 3 · LXL04_006531 · OH-1004

Cell membrane0.085

Rank 4 · LXL04_006531 · OH-1004

Cytoplasm0.079

Rank 5 · LXL04_006531 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1082-504 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006531	`PF00450.29`	Peptidase_S10	82	504	4.4e-143	478.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9Y0`	Arabidopsis thaliana	Serine carboxypeptidase-like 25	76.749%	Swiss-Prot	strong database homology
`Q9M099`	Arabidopsis thaliana	Serine carboxypeptidase 24	61.211%	Swiss-Prot	strong database homology
`O82229`	Arabidopsis thaliana	Putative serine carboxypeptidase-like 23	61.174%	Swiss-Prot	strong database homology
`Q1PF08`	Arabidopsis thaliana	Serine carboxypeptidase-like 22	60.497%	Swiss-Prot	strong database homology
`Q9SFB5`	Arabidopsis thaliana	Serine carboxypeptidase-like 27	56.757%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card