LXL04_006530 | RubberDandelionOmics

Gene overview

LXL04_006530

Reference: OH-1004 Chr: Chr02 Coordinates: 13022050-13022492 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · LXL04_006530|LXL04_006530|OH1004|cDNA

ATGTTCGTCTCTGCCGCATCTGGTTCTCACATGATCGTCGATGTCTCACACAGCGATCGTTTGATGGTCGAAGCGGAAGCGAGGAACATGCAGGAGAATCTCAACTGTCTGATTCACGATCAGGATGGAGTTTATGGCACGAATTGCCCAATCCCACCTGGTCAAAACTTCACCTACAATCTTCAAGTGAAGGATCAAATCGGAGATTTCACCATTCTCGCCGGTGACTGGTTCAAGCAAAGCCACACCCCTCCTGGTAA...

CDS

Download CDS FASTA

345 bp · LXL04_006530|LXL04_006530|OH1004|CDS

ATGTTCGTCTCTGCCGCATCTGGTTCTCACATGATCGTCGATGTCTCACACAGCGATCGTTTGATGGTCGAAGCGGAAGCGAGGAACATGCAGGAGAATCTCAACTGTCTGATTCACGATCAGGATGGAGTTTATGGCACGAATTGCCCAATCCCACCTGGTCAAAACTTCACCTACAATCTTCAAGTGAAGGATCAAATCGGAGATTTCACCATTCTCGCCGGTGACTGGTTCAAGCAAAGCCACACCCCTCCTGGTAA...

Protein

Download Protein FASTA

114 aa · LXL04_006530|LXL04_006530|OH1004|PROTEIN

MFVSAASGSHMIVDVSHSDRLMVEAEARNMQENLNCLIHDQDGVYGTNCPIPPGQNFTYNLQVKDQIGDFTILAGDWFKQSHTPPGKKIGKIHCEFCFWILAYLRAFGIASFWL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006530`
TK1151 ID	TkA03G046500
OH-1004 ID	LXL04_006530
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006530

Location Chr02:13022050-13022492 (+)

Description Similar to SKS1: Monocopper oxidase-like protein SKS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55560`	Probable oxidoreductase that may be involved in pollen tube growth.	Two Arabidopsis late pollen transcripts are detected in cytoplasmic granules.2017 · DOI: 10.1002/pld3.12
`At4g25240`	Monocopper oxidase-like protein SKS1.	No verified direct reference in this release
`At5g51480`	Monocopper oxidase-like protein SKS2.	No verified direct reference in this release
`At4g12420`	May be a monocopper oxidase of unknown specificity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006530 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55560

ath:AT4G12420

ath:AT4G25240

ath:AT5G51480

nta:107766889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.262

Rank 1 · LXL04_006530 · OH-1004

Extracellular0.245

Rank 2 · LXL04_006530 · OH-1004

Nucleus0.194

Rank 3 · LXL04_006530 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_006530 · OH-1004

Cell membrane0.125

Rank 5 · LXL04_006530 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732.22Cu-oxidase_341-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006530	`PF07732.22`	Cu-oxidase_3	41	69	2.4e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMW3`	Arabidopsis thaliana	Protein SKU5 SIMILAR 14	36.264%	Swiss-Prot	weak database homology
`Q8VXX5`	Arabidopsis thaliana	Monocopper oxidase-like protein SKS1	80.000%	Swiss-Prot	weak database homology
`Q9FHN6`	Arabidopsis thaliana	Monocopper oxidase-like protein SKS2	73.333%	Swiss-Prot	weak database homology
`Q9SU40`	Arabidopsis thaliana	Monocopper oxidase-like protein SKU5	76.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card