LXL04_006522 | RubberDandelionOmics

Gene overview

LXL04_006522

Reference: OH-1004 Chr: Chr02 Coordinates: 12765270-12766315 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_006522|LXL04_006522|OH1004|cDNA

ATGGCGAGTACTCGAGATTCAAGCTATTCAAGGGATTTGTTGCAGAGATTTACATGCGGCGGAGGAGGGAATCGTAATCCGGTGAAACCAAAAGAGGAAGCTCATGGACCACCGGGAAACGTAGAGCTGAGTTTAGGGTTGTCGTTAAACGGTAATTTTGGGGTGGAACCAGAAAGAACGGCGGTTAATGACGGGAATATCGATAGAAAGCTATTTCGTGCTTCTTCGGTGAACGATTTCGTGAAGTTTTCGGTGGATGT...

CDS

Download CDS FASTA

939 bp · LXL04_006522|LXL04_006522|OH1004|CDS

ATGGCGAGTACTCGAGATTCAAGCTATTCAAGGGATTTGTTGCAGAGATTTACATGCGGCGGAGGAGGGAATCGTAATCCGGTGAAACCAAAAGAGGAAGCTCATGGACCACCGGGAAACGTAGAGCTGAGTTTAGGGTTGTCGTTAAACGGTAATTTTGGGGTGGAACCAGAAAGAACGGCGGTTAATGACGGGAATATCGATAGAAAGCTATTTCGTGCTTCTTCGGTGAACGATTTCGTGAAGTTTTCGGTGGATGT...

Protein

Download Protein FASTA

312 aa · LXL04_006522|LXL04_006522|OH1004|PROTEIN

MASTRDSSYSRDLLQRFTCGGGGNRNPVKPKEEAHGPPGNVELSLGLSLNGNFGVEPERTAVNDGNIDRKLFRASSVNDFVKFSVDVELSLYSPLTRTCSLPVETEAEWRKKKELQSLRRSEAKRKRVEKLKNVRVVKTKTVEDWDRNRSNSVKDGQLSEVGLKQSPPSSSTPSSPSPALQFTSQGSIGSQGSGGSSGVSDLDSQPFQGTNTKSQSQGRSESNKVDRTPKSNPRDGAWPDVQSMPCVSTKVEGSDGKKIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006522`
TK1151 ID	TkA03G045070
OH-1004 ID	LXL04_006522
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006522

Location Chr02:12765270-12766315 (+)

Description Similar to AFP2: Ninja-family protein AFP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13740`	Acts as a negative regulator of abscisic acid (ABA) response during germination through the ubiquitin-mediated proteolysis of ABI5/DPBF1.	A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.2008 · DOI: 10.1007/s11103-008-9344-2
`At1g69260`	Acts as a negative regulator of abscisic acid (ABA) response during germination through the ubiquitin-mediated proteolysis of ABI5/DPBF1.	No verified direct reference in this release
`At3g29575`	Acts as a negative regulator of abscisic acid (ABA) response and stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006522 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13740

ath:AT1G69260

ath:AT3G29575

zma:100283969

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · LXL04_006522 · OH-1004

Cytoplasm0.095

Rank 2 · LXL04_006522 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_006522 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_006522 · OH-1004

Plastid0.013

Rank 5 · LXL04_006522 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07897.17EAR41-78 aa

PF16136.11NLS_NINJA_AFP95-131 aa

PF16135.11TDBD273-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006522	`PF07897.17`	EAR	41	78	2.9e-08	33.9
LXL04_006522	`PF16136.11`	NLS_NINJA_AFP	95	131	8.3e-17	61.3
LXL04_006522	`PF16135.11`	TDBD	273	305	9.1e-08	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMX5`	Arabidopsis thaliana	Ninja-family protein AFP2	40.244%	Swiss-Prot	moderate database homology
`Q9LQ98`	Arabidopsis thaliana	Ninja-family protein AFP1	33.721%	Swiss-Prot	moderate database homology
`Q94F39`	Arabidopsis thaliana	Ninja-family protein AFP3	39.483%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card