LXL04_006498 | RubberDandelionOmics

Gene overview

LXL04_006498

Reference: OH-1004 Chr: Chr02 Coordinates: 12201916-12202443 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_006498|LXL04_006498|OH1004|cDNA

ATGACATTACTCCCAACTGCATCgcaaatcgatgtgaatcacCCTTCTGGACTCGATTGGACTACCGAGGTCTGCCGCTCCTCTATCAAATTCACTTCTGAAGGAACACGAGTCATGCAAGTATGCTGTACAAAAGACCTAAATTCAATAACCAACATCACCACAAATGACGAATTCCTCCGACGCAAATCCGGCGACCTAAGAATCATGTACGCCATAATCCGCACATACGAATCAAACTACTGGACCGAAGTCACAAT...

CDS

Download CDS FASTA

528 bp · LXL04_006498|LXL04_006498|OH1004|CDS

ATGACATTACTCCCAACTGCATCGCAAATCGATGTGAATCACCCTTCTGGACTCGATTGGACTACCGAGGTCTGCCGCTCCTCTATCAAATTCACTTCTGAAGGAACACGAGTCATGCAAGTATGCTGTACAAAAGACCTAAATTCAATAACCAACATCACCACAAATGACGAATTCCTCCGACGCAAATCCGGCGACCTAAGAATCATGTACGCCATAATCCGCACATACGAATCAAACTACTGGACCGAAGTCACAAT...

Protein

Download Protein FASTA

175 aa · LXL04_006498|LXL04_006498|OH1004|PROTEIN

MTLLPTASQIDVNHPSGLDWTTEVCRSSIKFTSEGTRVMQVCCTKDLNSITNITTNDEFLRRKSGDLRIMYAIIRTYESNYWTEVTIKNHNSLGRLDNWNLTWDWMRDEFINDIKGAYPYTRDSSPCIFGPQGTFYQQMDFSVVLNCKRSPTLIDLPLEMTNNTQRGKKFPSQSP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006498`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006498

Location Chr02:12201916-12202443 (+)

Description Similar to COBL7: COBRA-like protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16120`	COBRA-like protein 7.	No verified direct reference in this release
`At3g16860`	COBRA-like protein 8.	No verified direct reference in this release
`At5g49270`	COBRA-like protein 9.	No verified direct reference in this release
`At3g20580`	Involved in the deposition of apical pectin cap and cellulose microfibrils in pollen tubes.	Arabidopsis COBRA-LIKE 10, a GPI-anchored protein, mediates directional growth of pollen tubes.2013 · DOI: 10.1111/tpj.12139
`At4g27110`	Involved in the deposition of apical pectin cap and cellulose microfibrils in pollen tubes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G16860

ath:AT3G20580

ath:AT4G16120

ath:AT4G27110

ath:AT5G49270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.717

Rank 1 · LXL04_006498 · OH-1004

Cell membrane0.084

Rank 2 · LXL04_006498 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_006498 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_006498 · OH-1004

Nucleus0.039

Rank 5 · LXL04_006498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04833.21COBRA_N81-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006498	`PF04833.21`	COBRA_N	81	167	8.6e-24	85.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZ17`	Arabidopsis thaliana	COBRA-like protein 7	55.072%	Swiss-Prot	strong database homology
`Q9LIB6`	Arabidopsis thaliana	COBRA-like protein 8	52.113%	Swiss-Prot	strong database homology
`Q9FJ13`	Arabidopsis thaliana	COBRA-like protein 9	50.000%	Swiss-Prot	strong database homology
`Q9LJU0`	Arabidopsis thaliana	COBRA-like protein 10	44.615%	Swiss-Prot	moderate database homology
`Q9T045`	Arabidopsis thaliana	COBRA-like protein 11	40.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card