LXL04_006462 | RubberDandelionOmics

Gene overview

LXL04_006462

Reference: OH-1004 Chr: Chr02 Coordinates: 11347832-11354936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3303 bp · LXL04_006462|LXL04_006462|OH1004|cDNA

ATGCTAATCCTGCCGATAATCACATTCTTGAAAAGGTCGGTTCCATATAGCGCGGCGCCTACAAGGTTTATGCAGGGTTTTAACCTCGTACTCCCATCACACACAGGTTTATTCTTCGACCATGTCATAAACACGAAGCTTTATACTTCCCCCCTTTTACTAATTACCAACAAATTCCAGTCGTTCGTTGCTAATATTTTTTCTTACAAAATCATCACCATATTGATGTTCAGCACCCAATTCCATACTCACTCTGGTAT...

CDS

Download CDS FASTA

3303 bp · LXL04_006462|LXL04_006462|OH1004|CDS

ATGCTAATCCTGCCGATAATCACATTCTTGAAAAGGTCGGTTCCATATAGCGCGGCGCCTACAAGGTTTATGCAGGGTTTTAACCTCGTACTCCCATCACACACAGGTTTATTCTTCGACCATGTCATAAACACGAAGCTTTATACTTCCCCCCTTTTACTAATTACCAACAAATTCCAGTCGTTCGTTGCTAATATTTTTTCTTACAAAATCATCACCATATTGATGTTCAGCACCCAATTCCATACTCACTCTGGTAT...

Protein

Download Protein FASTA

1100 aa · LXL04_006462|LXL04_006462|OH1004|PROTEIN

MLILPIITFLKRSVPYSAAPTRFMQGFNLVLPSHTGLFFDHVINTKLYTSPLLLITNKFQSFVANIFSYKIITILMFSTQFHTHSGISVGQSHLVPSNTKPTNAFQLSSSKKSKVMWRSISQRVYLKIPPSFCLDSLSYRRNFNTLLAHSANPLNSEKLPLRAMKFDCSSPIKRYPERNSFEMGQIFAIGVGSQVGYNVKRYASVAEAVVSSSTDADDEINGGDEVQTLLSEMGKENQRQAIRGWWRQKRAKTGSSWNYM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006462`
TK1151 ID	TkA03G039380
OH-1004 ID	LXL04_006462
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 72.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006462

Location Chr02:11347832-11354936 (-)

Description Similar to RPOT2: DNA-directed RNA polymerase 2, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68990`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006462 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006390 mitochondrial transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0034245 mitochondrial DNA-directed RNA polymerase complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003899 DNA-directed RNA polymerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G68990

nsy:104218451

nsy:104225149

nta:107765810

nta:107784816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.703

Rank 1 · LXL04_006462 · OH-1004

Plastid0.267

Rank 2 · LXL04_006462 · OH-1004

Cytoplasm0.045

Rank 3 · LXL04_006462 · OH-1004

Nucleus0.044

Rank 4 · LXL04_006462 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_006462 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14700.12RPOL_N265-585 aa

PF00940.25RNA_pol709-1074 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006462	`PF14700.12`	RPOL_N	265	585	5.1e-88	296.4
LXL04_006462	`PF00940.25`	RNA_pol	709	1074	4.9e-163	543.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92969`	Arabidopsis thaliana	DNA-directed RNA polymerase 1, mitochondrial	61.976%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card