LXL04_006435 | RubberDandelionOmics

Gene overview

LXL04_006435

Reference: OH-1004 Chr: Chr02 Coordinates: 10719311-10722295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1617 bp · LXL04_006435|LXL04_006435|OH1004|cDNA

ATGATGGATGAAATTATTGAAAACAAAGACATCGATCTGGAAACTGAAGAAAACGATGATTTCAAAAGACAATTATGGAGAAAATTTCGCCCAAAGCTTTGGTTTTCATCCATTTGGAAGAAATATTCTCTCGAATCAAAGCTAAATAACATCAAAACATTCTTGAAGATTAACATCATTCCGGCTTCCATCTCTCTAGCAATGGGAATCTGTTACCTCCTCTTGAAATCAAAGGGGCAAAAATGTAAAGTTGTTCCATA...

CDS

Download CDS FASTA

1617 bp · LXL04_006435|LXL04_006435|OH1004|CDS

ATGATGGATGAAATTATTGAAAACAAAGACATCGATCTGGAAACTGAAGAAAACGATGATTTCAAAAGACAATTATGGAGAAAATTTCGCCCAAAGCTTTGGTTTTCATCCATTTGGAAGAAATATTCTCTCGAATCAAAGCTAAATAACATCAAAACATTCTTGAAGATTAACATCATTCCGGCTTCCATCTCTCTAGCAATGGGAATCTGTTACCTCCTCTTGAAATCAAAGGGGCAAAAATGTAAAGTTGTTCCATA...

Protein

Download Protein FASTA

538 aa · LXL04_006435|LXL04_006435|OH1004|PROTEIN

MMDEIIENKDIDLETEENDDFKRQLWRKFRPKLWFSSIWKKYSLESKLNNIKTFLKINIIPASISLAMGICYLLLKSKGQKCKVVPYSDLLKGLQDGSITRVQFKENSRSIMYNTNPQTSQSTKIVNKQHSKSYNDANFKEMVASFLAKLSRKHEGSSLTLTESNSKVLDFEEMKREKYNHGWEFSTRYIDDDYRELLHLMKEKGTTYGLDPEPFYVSGGRRVFSTLLNQAPSWAMLYMVSLGLGGGGSIARKPSKNDAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006435`
TK1151 ID	TkA03G037080
OH-1004 ID	LXL04_006435
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 99.814 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006435

Location Chr02:10719311-10722295 (-)

Description Similar to FTSHI3: Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02450`	Might be involved in chaperone functions or play a structural role in the thylakoid FtsH complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006435 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G02450

bph:Bphy_6007

cyb:CYB_0631

tro:trd_A0442

ttr:Tter_0172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.411

Rank 1 · LXL04_006435 · OH-1004

Plastid0.327

Rank 2 · LXL04_006435 · OH-1004

Cytoplasm0.128

Rank 3 · LXL04_006435 · OH-1004

Nucleus0.083

Rank 4 · LXL04_006435 · OH-1004

Endoplasmic reticulum0.068

Rank 5 · LXL04_006435 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191.13AAA_16294-328 aa

PF07728.21AAA_5298-365 aa

PF00004.36AAA299-427 aa

PF17862.8AAA_lid_3454-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006435	`PF13191.13`	AAA_16	294	328	9.1e-07	30.3
LXL04_006435	`PF07728.21`	AAA_5	298	365	8.2e-06	26.6
LXL04_006435	`PF00004.36`	AAA	299	427	5.9e-44	150.4
LXL04_006435	`PF17862.8`	AAA_lid_3	454	497	1.3e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M895`	Arabidopsis thaliana	Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic	54.622%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card