LXL04_006383 | RubberDandelionOmics

Gene overview

LXL04_006383

Reference: OH-1004 Chr: Chr02 Coordinates: 9217564-9225774 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2931 bp · LXL04_006383|LXL04_006383|OH1004|cDNA

ATGGATTCAAATGCTAAGATCTCGATTTTGGAAGGAACGGATGAACTCAAACTCCGAAATGATTCAAATGCGACTGTCTTGCAATCGGGAATGCTTGATGAAAAGGGTGGCGACGGCGagtcaagatcttttgagaactcatatattcccgagaacccgagaactcccaaaccgttaactttttcgaaaaaccgacttcggggggctaaaaatcgctcaaatataagcccggtcgcaaaaaaaaaatttccgaaaaaacg...

CDS

Download CDS FASTA

2931 bp · LXL04_006383|LXL04_006383|OH1004|CDS

ATGGATTCAAATGCTAAGATCTCGATTTTGGAAGGAACGGATGAACTCAAACTCCGAAATGATTCAAATGCGACTGTCTTGCAATCGGGAATGCTTGATGAAAAGGGTGGCGACGGCGAGTCAAGATCTTTTGAGAACTCATATATTCCCGAGAACCCGAGAACTCCCAAACCGTTAACTTTTTCGAAAAACCGACTTCGGGGGGCTAAAAATCGCTCAAATATAAGCCCGGTCGCAAAAAAAAAATTTCCGAAAAAACG...

Protein

Download Protein FASTA

976 aa · LXL04_006383|LXL04_006383|OH1004|PROTEIN

MDSNAKISILEGTDELKLRNDSNATVLQSGMLDEKGGDGESRSFENSYIPENPRTPKPLTFSKNRLRGAKNRSNISPVAKKKFPKKRLFFSKNFAYVQTFFFVHMSLYNTYLKRFVKKKFEKKRKKKSCTYAQKIKKSCTYAKVKKNIRIVMIKNVLEGSEVVRTIIKFENGGTNLDRYKSHTAALRRQKIDLRQTGISGLDSFLHCVQEDGTAVMEVARSSFEEELHPKNKFPFNSMSQDYIFNFSHGFERPSSQDQQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006383`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006383

Location Chr02:9217564-9225774 (-)

Description Similar to BLH6: BEL1-like homeodomain protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34610`	BEL1-like homeodomain protein 6.	No verified direct reference in this release
`At5g41410`	Plays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors.	Homeotic Transformation of Ovules into Carpel-like Structures in Arabidopsis.1994 · DOI: 10.1105/tpc.6.3.333 Genetic and molecular interactions between BELL1 and MADS box factors support ovule development in Arabidopsis.2007 · DOI: 10.1105/tpc.107.051797 The transcription factors BEL1 and SPL are required for cytokinin and auxin signaling during ovule development in Arabidopsis.2012 · DOI: 10.1105/tpc.112.100164
`At1g19700`	BEL1-like homeodomain protein 10.	No verified direct reference in this release
`At2g16400`	BEL1-like homeodomain protein 7.	No verified direct reference in this release
`At1g75410`	Transcription factor involved in the nuclear import of SHOOT MERISTEMLESS (STM).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006383 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0048481 plant ovule development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G19700

ath:AT1G75410

ath:AT2G16400

ath:AT4G34610

ath:AT5G41410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.916

Rank 1 · LXL04_006383 · OH-1004

Cytoplasm0.166

Rank 2 · LXL04_006383 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_006383 · OH-1004

Mitochondrion0.019

Rank 4 · LXL04_006383 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_006383 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07526.17POX529-660 aa

PF05920.18Homeobox_KN729-768 aa

PF00046.36Homeodomain736-768 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006383	`PF07526.17`	POX	529	660	3.5e-49	167.5
LXL04_006383	`PF05920.18`	Homeobox_KN	729	768	3.3e-19	69.2
LXL04_006383	`PF00046.36`	Homeodomain	736	768	5.7e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65685`	Arabidopsis thaliana	BEL1-like homeodomain protein 6	55.882%	Swiss-Prot	weak database homology
`Q38897`	Arabidopsis thaliana	Homeobox protein BEL1 homolog	52.222%	Swiss-Prot	weak database homology
`Q9FXG8`	Arabidopsis thaliana	BEL1-like homeodomain protein 10	53.069%	Swiss-Prot	weak database homology
`Q9SIW1`	Arabidopsis thaliana	BEL1-like homeodomain protein 7	51.379%	Swiss-Prot	weak database homology
`Q9FWS9`	Arabidopsis thaliana	BEL1-like homeodomain protein 3	52.577%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card