LXL04_006369 | RubberDandelionOmics

Gene overview

LXL04_006369

Reference: OH-1004 Chr: Chr02 Coordinates: 8980404-8981885 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_006369|LXL04_006369|OH1004|cDNA

ATGGAGATGATGAAGAATCCAATGCGAAGAATCATGCAGATTAGTTGGAGGAATTCTCGGAAATCACTGAAGAGGAAAGATGGCGATGATGACGACAATTTTTACGATGCCGTCGGCGAACCATCTGCTGACAACAATGGAAATATCTCCGACACCACCGATCCACCGCCGCCTCCGTCGTCTGACACCGATTCCACGGTTGATGGTTCTCAATGCGATTCATACATTCCAACTCCATTTTATCGCCTACCAAGCTCCGC...

CDS

Download CDS FASTA

1482 bp · LXL04_006369|LXL04_006369|OH1004|CDS

ATGGAGATGATGAAGAATCCAATGCGAAGAATCATGCAGATTAGTTGGAGGAATTCTCGGAAATCACTGAAGAGGAAAGATGGCGATGATGACGACAATTTTTACGATGCCGTCGGCGAACCATCTGCTGACAACAATGGAAATATCTCCGACACCACCGATCCACCGCCGCCTCCGTCGTCTGACACCGATTCCACGGTTGATGGTTCTCAATGCGATTCATACATTCCAACTCCATTTTATCGCCTACCAAGCTCCGC...

Protein

Download Protein FASTA

493 aa · LXL04_006369|LXL04_006369|OH1004|PROTEIN

MEMMKNPMRRIMQISWRNSRKSLKRKDGDDDDNFYDAVGEPSADNNGNISDTTDPPPPPSSDTDSTVDGSQCDSYIPTPFYRLPSSAQTSPLSKSPWSSYTEPPDPAATDTSGDYVGLMTSLVREEGHIYSLAASGDLLYTGSSSKNIRVWKSQKEYSGFKAHSGLVKSIVLSGDKIFTGHQDGKIRVWKALTRDPKVHKKIGTLPSFGSVIKKSMIPNNYTEMWRNRSGIWIKHFDAISSLSLNEDGTLLYSGSWDKTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006369`
TK1151 ID	TkAUNG076380
OH-1004 ID	LXL04_006369
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.300
Protein coverage (%)	TK1151 82.738 / OH-1004 28.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006369

Location Chr02:8980404-8981885 (+)

Description Similar to JGB: Protein JINGUBANG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26490`	Negative regulator of pollen germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006369 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0031037 myosin II filament disassembly Biological Process

GO:1903013 response to differentiation-inducing factor 1 Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005826 actomyosin contractile ring Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016905 myosin heavy chain kinase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0045159 myosin II binding Molecular Function

KEGG gene cross-reference

ath:AT2G26490

ddi:DDB_G0289115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.421

Rank 1 · LXL04_006369 · OH-1004

Cytoplasm0.364

Rank 2 · LXL04_006369 · OH-1004

Cell membrane0.251

Rank 3 · LXL04_006369 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_006369 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_006369 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24017.3Beta-prop_SCAP113-354 aa

PF23381.2Beta-prop_IFT122_1st122-196 aa

PF24817.2WD40_WDHD1_1st123-216 aa

PF25171.2Beta-prop_WDR36-Utp21_1st126-221 aa

PF24807.2WD40_CDC20-Fz131-284 aa

PF25175.2Beta-prop_WDR5134-193 aa

PF25174.2Beta-prop_THOC3134-195 aa

PF24817.2WD40_WDHD1_1st228-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006369	`PF24017.3`	Beta-prop_SCAP	113	354	6.5e-16	58.9
LXL04_006369	`PF23381.2`	Beta-prop_IFT122_1st	122	196	2.1e-28	100.2
LXL04_006369	`PF24817.2`	WD40_WDHD1_1st	123	216	2.6e-28	99.8
LXL04_006369	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	126	221	1.1e-11	45.4
LXL04_006369	`PF24807.2`	WD40_CDC20-Fz	131	284	2.8e-22	80.1
LXL04_006369	`PF25175.2`	Beta-prop_WDR5	134	193	8.4e-34	117.9
LXL04_006369	`PF25174.2`	Beta-prop_THOC3	134	195	4.4e-29	102.0
LXL04_006369	`PF24817.2`	WD40_WDHD1_1st	228	310	2.6e-28	99.8
LXL04_006369	`PF25391.2`	WD40_Gbeta	232	392	7e-16	58.9
LXL04_006369	`PF00400.39`	WD40	234	263	5.8e-42	141.1
LXL04_006369	`PF25175.2`	Beta-prop_WDR5	234	307	8.4e-34	117.9
LXL04_006369	`PF24796.2`	WDR55	234	417	5.7e-16	59.1
LXL04_006369	`PF25173.2`	Beta-prop_WDR3_1st	235	309	4.6e-37	128.2
LXL04_006369	`PF25047.1`	Beta-prop_TEP1_2nd	235	307	5.7e-21	75.5
LXL04_006369	`PF24805.2`	EIF3I	235	311	9.7e-17	61.8
LXL04_006369	`PF25174.2`	Beta-prop_THOC3	236	354	4.4e-29	102.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48716`	Arabidopsis thaliana	Protein JINGUBANG	58.630%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card