LXL04_006366 | RubberDandelionOmics

Gene overview

LXL04_006366

Reference: OH-1004 Chr: Chr02 Coordinates: 8960525-8964517 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2364 bp · LXL04_006366|LXL04_006366|OH1004|cDNA

ATGCGTCAGTTCTTAACAGCTCTCAGGCACCACCACCGATATCTCCTTCGTCGACCGAACCCCTCTTTTACCATTCGATTCGCCTCAGCGCACTACAAACCCCATAAACCACCGCCTCCACCAGCACCACCAACACCCCCAAAACCACCGCAGAAACCCGCCACGTTCACACTCCATGACTACTCGTGGGAAGATCCTTACAGCTGGATGTCCAATCTCAACGATAAAGTGGCGATGCGCCACATGGACATGTACATGGA...

CDS

Download CDS FASTA

2364 bp · LXL04_006366|LXL04_006366|OH1004|CDS

ATGCGTCAGTTCTTAACAGCTCTCAGGCACCACCACCGATATCTCCTTCGTCGACCGAACCCCTCTTTTACCATTCGATTCGCCTCAGCGCACTACAAACCCCATAAACCACCGCCTCCACCAGCACCACCAACACCCCCAAAACCACCGCAGAAACCCGCCACGTTCACACTCCATGACTACTCGTGGGAAGATCCTTACAGCTGGATGTCCAATCTCAACGATAAAGTGGCGATGCGCCACATGGACATGTACATGGA...

Protein

Download Protein FASTA

787 aa · LXL04_006366|LXL04_006366|OH1004|PROTEIN

MRQFLTALRHHHRYLLRRPNPSFTIRFASAHYKPHKPPPPPAPPTPPKPPQKPATFTLHDYSWEDPYSWMSNLNDKVAMRHMDMYMEQEEKYTEAVLADTDRLQSKLQSEMASRMSSQLSTPPFRWGPWLYYRRVEEGKQYPVLCRRLASLNDEFISHKSPTAGFDFISGKRIEQILIDYNKEAERFGGYAYEEVSEISPDHRFIAYTMYDKDNDFFKLCVRDLNFGSLCSKPQADWVCNVAWAKGGQALIYVVTDQNKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006366`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_006366`
Location	Chr02:8960525-8964517 (-)
Description	Similar to dapb1: Dipeptidyl aminopeptidase BI
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006366` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0004177 aminopeptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function GO:0008239 dipeptidyl-peptidase activity Molecular Function GO:0070012 oligopeptidase activity Molecular Function
KEGG gene cross-reference	ecj:JW1834 eco:b1845 ecoc:C3026_10510 rhi:NGR_a01920 xla:100381109 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.468

Rank 1 · LXL04_006366 · OH-1004

Cytoplasm0.299

Rank 2 · LXL04_006366 · OH-1004

Mitochondrion0.200

Rank 3 · LXL04_006366 · OH-1004

Nucleus0.119

Rank 4 · LXL04_006366 · OH-1004

Peroxisome0.057

Rank 5 · LXL04_006366 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02897.22Peptidase_S9_N51-486 aa

PF00326.28Peptidase_S9579-745 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006366	`PF02897.22`	Peptidase_S9_N	51	486	3e-42	145.6
LXL04_006366	`PF00326.28`	Peptidase_S9	579	745	1.2e-32	113.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card