LXL04_006167 | RubberDandelionOmics

Gene overview

LXL04_006167

Reference: OH-1004 Chr: Chr02 Coordinates: 2979806-2982445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_006167|LXL04_006167|OH1004|cDNA

ATGCATCCGCCGACATCCTTCACGCGTCCCTGCTGCTTCTTCCTCGCTGGTTCACGACCTCCATTGTTCTTCTTCCTCGCCGTGGTATTCAAGCTGTCCAAAAGAACTGCTGATGAGAACTTGCAGTCACTTCATAGCATCCTTTTTGGAAAACGAGCAAAGTCGAAGGaaggagatgatgatgatgatgatgaagaagaacAGAAAGAACAGGAAGATGATAAAATAGCAAAAAGCTCTTCAAAAAAGCGTGTGAAGAA...

CDS

Download CDS FASTA

480 bp · LXL04_006167|LXL04_006167|OH1004|CDS

ATGCATCCGCCGACATCCTTCACGCGTCCCTGCTGCTTCTTCCTCGCTGGTTCACGACCTCCATTGTTCTTCTTCCTCGCCGTGGTATTCAAGCTGTCCAAAAGAACTGCTGATGAGAACTTGCAGTCACTTCATAGCATCCTTTTTGGAAAACGAGCAAAGTCGAAGGAAGGAGATGATGATGATGATGATGAAGAAGAACAGAAAGAACAGGAAGATGATAAAATAGCAAAAAGCTCTTCAAAAAAGCGTGTGAAGAA...

Protein

Download Protein FASTA

159 aa · LXL04_006167|LXL04_006167|OH1004|PROTEIN

MHPPTSFTRPCCFFLAGSRPPLFFFLAVVFKLSKRTADENLQSLHSILFGKRAKSKEGDDDDDDEEEQKEQEDDKIAKSSSKKRVKKDSGEKSKSVNKETKSVKKTHVSSSKSKKIRKKRKSKTKGKSNKKAKVEPTNEDMHAVVTKILKEVDFNTSVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006167`
TK1151 ID	TkA03G014390
OH-1004 ID	LXL04_006167
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 92.442 / OH-1004 98.742 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006167

Location Chr02:2979806-2982445 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48710`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006167 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:2000779 regulation of double-strand break repair Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0042393 histone binding Molecular Function

KEGG gene cross-reference

ath:AT3G48710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · LXL04_006167 · OH-1004

Cytoplasm0.135

Rank 2 · LXL04_006167 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_006167 · OH-1004

Mitochondrion0.019

Rank 4 · LXL04_006167 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_006167 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMM8`	Arabidopsis thaliana	DEK domain-containing chromatin-associated protein 1	37.857%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card