LXL04_006161 | RubberDandelionOmics

Gene overview

LXL04_006161

Reference: OH-1004 Chr: Chr02 Coordinates: 2936319-2941550 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2037 bp · LXL04_006161|LXL04_006161|OH1004|cDNA

ATGATGAACCGGGTGCTGACAACGCCTGCCACCCGTCTCCGCCAACACCTTACCCGGCCGGCGTTGAATACCGTCGCCACAGATCAAGCTAACAGCGCGACATTCTGGCATTACCAGATCCTCGATCCAAACGGAGAAGCCGTGACTCGATGGTACCAATTTTTCCTCGTGGTCTGCCTCGTATCTCTCTTCATAGATCCGCTTTATTTCTACCTACCTTACGTCGGCGGCGACACCTGCATGACCAAGGATCACGCCGC...

CDS

Download CDS FASTA

2037 bp · LXL04_006161|LXL04_006161|OH1004|CDS

ATGATGAACCGGGTGCTGACAACGCCTGCCACCCGTCTCCGCCAACACCTTACCCGGCCGGCGTTGAATACCGTCGCCACAGATCAAGCTAACAGCGCGACATTCTGGCATTACCAGATCCTCGATCCAAACGGAGAAGCCGTGACTCGATGGTACCAATTTTTCCTCGTGGTCTGCCTCGTATCTCTCTTCATAGATCCGCTTTATTTCTACCTACCTTACGTCGGCGGCGACACCTGCATGACCAAGGATCACGCCGC...

Protein

Download Protein FASTA

678 aa · LXL04_006161|LXL04_006161|OH1004|PROTEIN

MMNRVLTTPATRLRQHLTRPALNTVATDQANSATFWHYQILDPNGEAVTRWYQFFLVVCLVSLFIDPLYFYLPYVGGDTCMTKDHAAAIAINTWRSLADVFFLLHIIMKFRTAFIAPSSKVFGRGELVMDKRQIALRYMRSDLVIDVAAMLPLPQIVHWLIIPATKTSTKDHANNTLSLIVLIQYIPRLFVIFPLNQRIIKSTGFVAKTAWAGAAYNLLLYMLASHVLGATWYSMSIARQHSCWQQGCKEEMASKDCIKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006161`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006161

Location Chr02:2936319-2941550 (-)

Description Similar to CNGC18: Cyclic nucleotide-gated ion channel 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14870`	Cyclic nucleotide-gated ion channel required for directional pollen tube growth into the transmitting tract.	A cyclic nucleotide-gated channel is essential for polarized tip growth of pollen.2007 · DOI: 10.1073/pnas.0701781104 Cyclic nucleotide-gated channel 18 is an essential Ca2+ channel in pollen tube tips for pollen tube guidance to ovules in Arabidopsis.2016 · DOI: 10.1073/pnas.1524629113
`At3g48010`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At2g24610`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30360`	Probable cyclic nucleotide-gated ion channel.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306
`At2g28260`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT2G24610

ath:AT2G28260

ath:AT3G48010

ath:AT4G30360

ath:AT5G14870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.893

Rank 1 · LXL04_006161 · OH-1004

Cytoplasm0.089

Rank 2 · LXL04_006161 · OH-1004

Endoplasmic reticulum0.055

Rank 3 · LXL04_006161 · OH-1004

Nucleus0.027

Rank 4 · LXL04_006161 · OH-1004

Golgi apparatus0.021

Rank 5 · LXL04_006161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans51-373 aa

PF00027.36cNMP_binding469-557 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006161	`PF00520.38`	Ion_trans	51	373	2.1e-19	70.4
LXL04_006161	`PF00027.36`	cNMP_binding	469	557	1.7e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEQ3`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 18	66.471%	Swiss-Prot	strong database homology
`Q9SU64`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 16	62.256%	Swiss-Prot	strong database homology
`Q9SJA4`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 14	60.843%	Swiss-Prot	strong database homology
`Q8L7Z0`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 17	59.297%	Swiss-Prot	strong database homology
`Q9SL29`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 15	57.432%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card