Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · LXL04_006157|LXL04_006157|OH1004|cDNA
ATGGTGGAAGCAACTGTAATTTTGGAAACAATGATCAAGACAGAGTATATCAAGAACACATGGTGGTGGTACTGGTCTTCAATGGCGGCTGCCGCCAAAACATCCACCATCTCTGCCCTTGCTCTTCGTATCTACACACTCGACGCCGCCATCGACTACCAGAAAACCACCATCGCCGCCACCTCTTCCGGACAAAAACAGGACAAATCCATTATGAACTTCTTATGTTTTCATCTTCTCTCATCCATGGCTTCCTTTCT...
618 bp · LXL04_006157|LXL04_006157|OH1004|CDS
ATGGTGGAAGCAACTGTAATTTTGGAAACAATGATCAAGACAGAGTATATCAAGAACACATGGTGGTGGTACTGGTCTTCAATGGCGGCTGCCGCCAAAACATCCACCATCTCTGCCCTTGCTCTTCGTATCTACACACTCGACGCCGCCATCGACTACCAGAAAACCACCATCGCCGCCACCTCTTCCGGACAAAAACAGGACAAATCCATTATGAACTTCTTATGTTTTCATCTTCTCTCATCCATGGCTTCCTTTCT...
Protein
Download Protein FASTA205 aa · LXL04_006157|LXL04_006157|OH1004|PROTEIN
MVEATVILETMIKTEYIKNTWWWYWSSMAAAAKTSTISALALRIYTLDAAIDYQKTTIAATSSGQKQDKSIMNFLCFHLLSSMASFLQKLVRKNQSSTTLITNLNKRILSPSSHLLDPKPRPVAPIPFFNTLTKTTDESNTHSHLSSFHPSFAFESFLDPIAQPGFIQHVVPEEDIDSDDDQKGMWADSVKKKRKKHKLPAVSQI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_006157 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_006157 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr02:2829998-2830856 (-) | ||||||
| Description | Similar to MBD9: Methyl-CpG-binding domain-containing protein 9 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0010223 secondary shoot formation Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0048573 photoperiodism, flowering Biological Process GO:0000812 Swr1 complex Cellular Component GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0004402 histone acetyltransferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0008327 methyl-CpG binding Molecular Function GO:0042393 histone binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT3G01460 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9SGH2 | Arabidopsis thaliana | Methyl-CpG-binding domain-containing protein 9 | 65.455% | Swiss-Prot | weak database homology |