LXL04_006135 | RubberDandelionOmics

Gene overview

LXL04_006135

Reference: OH-1004 Chr: Chr02 Coordinates: 2117764-2122785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_006135|LXL04_006135|OH1004|cDNA

ATGGCTTCTGGTGCAATGGCTCCTACTCAAGTTGAAAAATCCGGTGCAAATTCAATGTTTGTTGATAAACTGCCTGAGGGAATCAATGAAATGACAATCAAAGACGACAAAGTCGAAAAGGAAATGGAGGCAACTGTGGTAGATGGAAATGGGACTGAAACTGGTCATATTATTGTTACAACTATTGGAGGTAGAAATGGTCAACCTAAACAGACAATAAGCTATATGGCAGAACGGGTCGTGGGCCAGGGTTCTTTTGG...

CDS

Download CDS FASTA

1233 bp · LXL04_006135|LXL04_006135|OH1004|CDS

ATGGCTTCTGGTGCAATGGCTCCTACTCAAGTTGAAAAATCCGGTGCAAATTCAATGTTTGTTGATAAACTGCCTGAGGGAATCAATGAAATGACAATCAAAGACGACAAAGTCGAAAAGGAAATGGAGGCAACTGTGGTAGATGGAAATGGGACTGAAACTGGTCATATTATTGTTACAACTATTGGAGGTAGAAATGGTCAACCTAAACAGACAATAAGCTATATGGCAGAACGGGTCGTGGGCCAGGGTTCTTTTGG...

Protein

Download Protein FASTA

410 aa · LXL04_006135|LXL04_006135|OH1004|PROTEIN

MASGAMAPTQVEKSGANSMFVDKLPEGINEMTIKDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETAYRVARHYSKANQRMPMIYVKLYTYQIFRSLAYIHAIGVCHRDIKPQNLLVNPHSHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTSAIDIWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006135`
TK1151 ID	TkA03G010690
OH-1004 ID	LXL04_006135
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006135

Location Chr02:2117764-2122785 (-)

Description Similar to ASK5: Shaggy-related protein kinase epsilon

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g26751`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At3g05840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006135 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0016310 phosphorylation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005938 cell cortex Cellular Component

KEGG gene cross-reference

ath:AT3G05840

ath:AT5G14640

ath:AT5G26751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · LXL04_006135 · OH-1004

Nucleus0.548

Rank 2 · LXL04_006135 · OH-1004

Cell membrane0.074

Rank 3 · LXL04_006135 · OH-1004

Mitochondrion0.044

Rank 4 · LXL04_006135 · OH-1004

Endoplasmic reticulum0.033

Rank 5 · LXL04_006135 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase76-358 aa

PF07714.24PK_Tyr_Ser-Thr78-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006135	`PF00069.32`	Pkinase	76	358	1.1e-62	212.5
LXL04_006135	`PF07714.24`	PK_Tyr_Ser-Thr	78	276	9.6e-25	88.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZD5`	Arabidopsis thaliana	Shaggy-related protein kinase epsilon	86.165%	Swiss-Prot	strong database homology
`P43288`	Arabidopsis thaliana	Shaggy-related protein kinase alpha	84.878%	Swiss-Prot	strong database homology
`P43289`	Arabidopsis thaliana	Shaggy-related protein kinase gamma	83.698%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card