LXL04_006073 | RubberDandelionOmics

Gene overview

LXL04_006073

Reference: OH-1004 Chr: Chr02 Coordinates: 1352799-1355339 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_006073|LXL04_006073|OH1004|cDNA

ATGCAAACGGGGCGGGGATTCCCCGCTACCCGCGGAGACCCGAACCGAATGGAGCGAGGATTCCCCGTTTTAGCGGGTAATGGGTCGGGGATGGAGCGCCGACAAACAACAATCTTCATGGAAGATCCTACCGAAAATCTCATCAATGAGAATGAAGAACAAACTCAACAGCCTACAAGAGATGCAGAAGTGCTGCAACAACAAGATGCTGGAACTGGTGCACAAGCTAATGGTACAACAGATGCACAAGTTGATGGTAT...

CDS

Download CDS FASTA

1737 bp · LXL04_006073|LXL04_006073|OH1004|CDS

ATGCAAACGGGGCGGGGATTCCCCGCTACCCGCGGAGACCCGAACCGAATGGAGCGAGGATTCCCCGTTTTAGCGGGTAATGGGTCGGGGATGGAGCGCCGACAAACAACAATCTTCATGGAAGATCCTACCGAAAATCTCATCAATGAGAATGAAGAACAAACTCAACAGCCTACAAGAGATGCAGAAGTGCTGCAACAACAAGATGCTGGAACTGGTGCACAAGCTAATGGTACAACAGATGCACAAGTTGATGGTAT...

Protein

Download Protein FASTA

578 aa · LXL04_006073|LXL04_006073|OH1004|PROTEIN

MQTGRGFPATRGDPNRMERGFPVLAGNGSGMERRQTTIFMEDPTENLINENEEQTQQPTRDAEVLQQQDAGTGAQANGTTDAQVDGINNTETFEATDAQADGTNRRLTSVVWNHFKKAKIEGVDKAICNYCGKKLSGKSKNGTTHLRDHYNICMARKNKDIRQTILNPRQEKKDGPVSLGTHTFDQNVSMSELAKMIVLHEYPINMVEHIGFRNFVNSVNPLFKHVSRTTIKSDIKRIYDIQKTKIKKIMSANQGRVAVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006073`
TK1151 ID	TkA03G430590
OH-1004 ID	LXL04_006073
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 77.688 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006073

Location Chr02:1352799-1355339 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0733400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0239150`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0583200`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006073 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0032196 transposition Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0733400

dosa:Os05g0239150

dosa:Os05g0583200

osa:4339741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.896

Rank 1 · LXL04_006073 · OH-1004

Cytoplasm0.141

Rank 2 · LXL04_006073 · OH-1004

Mitochondrion0.038

Rank 3 · LXL04_006073 · OH-1004

Cell membrane0.015

Rank 4 · LXL04_006073 · OH-1004

Extracellular0.012

Rank 5 · LXL04_006073 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02892.22zf-BED109-149 aa

PF27041.1ZBED1_RNase-like260-355 aa

PF27039.1ZBED1_RNase-like_helical360-468 aa

PF14372.13hAT-like_RNase-H489-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006073	`PF02892.22`	zf-BED	109	149	1e-08	35.7
LXL04_006073	`PF27041.1`	ZBED1_RNase-like	260	355	7.6e-27	94.0
LXL04_006073	`PF27039.1`	ZBED1_RNase-like_helical	360	468	5.5e-33	114.1
LXL04_006073	`PF14372.13`	hAT-like_RNase-H	489	577	9.7e-26	90.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AVI0`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 2	31.465%	Swiss-Prot	moderate database homology
`B9FJG3`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 1	32.454%	Swiss-Prot	moderate database homology
`Q75HY5`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 3	31.579%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card