LXL04_006002 | RubberDandelionOmics

Gene overview

LXL04_006002

Reference: OH-1004 Chr: Chr01 Coordinates: 176823314-176828531 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4191 bp · LXL04_006002|LXL04_006002|OH1004|cDNA

ATGTCGATCCTCCAAAAACTGGATCACTTTAGGTTTCCGCTTGAAGACATAAAAAAGGCAACCAACAATTTTAGTTCTGAAAATGTTATTGGCCCAGGTGGTTATGGGATAGTGTATAAAGGAGAGCTCTTACACTCGAAAGTAGTTGTCACAATTGCAGCAAAGCGGGTTGATAGGAGATTTGGCCATGGAGAAAGCCATTTCTTGAACGAAATCAGAGTGCTTTctttatataaacatgtaaATATTGTCCCTTTCAT...

CDS

Download CDS FASTA

4191 bp · LXL04_006002|LXL04_006002|OH1004|CDS

ATGTCGATCCTCCAAAAACTGGATCACTTTAGGTTTCCGCTTGAAGACATAAAAAAGGCAACCAACAATTTTAGTTCTGAAAATGTTATTGGCCCAGGTGGTTATGGGATAGTGTATAAAGGAGAGCTCTTACACTCGAAAGTAGTTGTCACAATTGCAGCAAAGCGGGTTGATAGGAGATTTGGCCATGGAGAAAGCCATTTCTTGAACGAAATCAGAGTGCTTTCTTTATATAAACATGTAAATATTGTCCCTTTCAT...

Protein

Download Protein FASTA

1396 aa · LXL04_006002|LXL04_006002|OH1004|PROTEIN

MSILQKLDHFRFPLEDIKKATNNFSSENVIGPGGYGIVYKGELLHSKVVVTIAAKRVDRRFGHGESHFLNEIRVLSLYKHVNIVPFIGFCDEYNEKILVEKFAAYGSLDNYVSSTKLNWMNRIQICLGAARGLNYLHNGLEGHTVFHRDIRSRTILLDTNWEPKIAGLGVSMMDSMHHDTDYGIIGAPGYVDPTLLQTGIVTKESDVYSFGMVLFEVLCGRLTYQTNENEFLGTVARVHYGNGTLNEIIDPILRKQMNQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006002`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006002

Location Chr01:176823314-176828531 (+)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010038 response to metal ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · LXL04_006002 · OH-1004

Cell membrane0.302

Rank 2 · LXL04_006002 · OH-1004

Nucleus0.292

Rank 3 · LXL04_006002 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_006002 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_006002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase25-289 aa

PF07714.24PK_Tyr_Ser-Thr27-290 aa

PF07714.24PK_Tyr_Ser-Thr352-655 aa

PF00069.32Pkinase394-653 aa

PF07714.24PK_Tyr_Ser-Thr684-944 aa

PF00069.32Pkinase689-942 aa

PF14299.14PP21023-1148 aa

PF14299.14PP21231-1395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006002	`PF00069.32`	Pkinase	25	289	4.7e-92	308.8
LXL04_006002	`PF07714.24`	PK_Tyr_Ser-Thr	27	290	2.3e-107	358.8
LXL04_006002	`PF07714.24`	PK_Tyr_Ser-Thr	352	655	2.3e-107	358.8
LXL04_006002	`PF00069.32`	Pkinase	394	653	4.7e-92	308.8
LXL04_006002	`PF07714.24`	PK_Tyr_Ser-Thr	684	944	2.3e-107	358.8
LXL04_006002	`PF00069.32`	Pkinase	689	942	4.7e-92	308.8
LXL04_006002	`PF14299.14`	PP2	1023	1148	3.8e-33	115.3
LXL04_006002	`PF14299.14`	PP2	1231	1395	3.8e-33	115.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	36.813%	Swiss-Prot	weak database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	36.538%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	37.500%	Swiss-Prot	weak database homology
`O80623`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g39360	37.349%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	38.095%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card