LXL04_005907 | RubberDandelionOmics

Gene overview

LXL04_005907

Reference: OH-1004 Chr: Chr01 Coordinates: 175556902-175559780 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · LXL04_005907|LXL04_005907|OH1004|cDNA

ATGGccgaagaagaaaagaatgaaGAGGTTACATCATCTACAGTAGAAGATCAGGAAATTCTTCGCTCTGATTCCACAGTTTCTCCTTCTGCTGAAGATAAGAATGACGAGATTTGTGACAACTCAACACTAAAGGAAACTGAGGAGAATTGTCACAAGTCAACACCAAAAGAAATTGAGGAGAGTTGTGACAACTCACCACCAAAGGAAATTGAGGAGAATTGTGACAAATCAACACCAAAGGAAATTGAGGAGAATTG...

CDS

Download CDS FASTA

1629 bp · LXL04_005907|LXL04_005907|OH1004|CDS

ATGGCCGAAGAAGAAAAGAATGAAGAGGTTACATCATCTACAGTAGAAGATCAGGAAATTCTTCGCTCTGATTCCACAGTTTCTCCTTCTGCTGAAGATAAGAATGACGAGATTTGTGACAACTCAACACTAAAGGAAACTGAGGAGAATTGTCACAAGTCAACACCAAAAGAAATTGAGGAGAGTTGTGACAACTCACCACCAAAGGAAATTGAGGAGAATTGTGACAAATCAACACCAAAGGAAATTGAGGAGAATTG...

Protein

Download Protein FASTA

542 aa · LXL04_005907|LXL04_005907|OH1004|PROTEIN

MAEEEKNEEVTSSTVEDQEILRSDSTVSPSAEDKNDEICDNSTLKETEENCHKSTPKEIEESCDNSPPKEIEENCDKSTPKEIEENCDKSTPNEIEENCDKSTVNEIEEKSESEKASHKAIVASSSSSSFKFGLIDLVTQIDPRSQPLQWCGFLRKLSKVPSASLLAFNPYLPSLPSIKRTKKKPSRKHTLSMPDIPPSIDPNLYCFEPSWTIYSLSDLKDATNNFDHDNLIGEGGYSEVFKGELQDGQIIAVKRLIRGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005907`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005907

Location Chr01:175556902-175559780 (-)

Description Similar to RBK2: Receptor-like cytosolic serine/threonine-protein kinase RBK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At2g16750`	Promotes cell proliferation in the gibberellic acid (GA) signaling pathway, acting downstream of RGA, and possibly through a negative regulation of two cyclin-dependent kinase inhibitors SIM and SMR1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005907 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G68690

ath:AT2G16750

ath:AT3G05140

ath:AT5G10520

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.659

Rank 1 · LXL04_005907 · OH-1004

Cytoplasm0.247

Rank 2 · LXL04_005907 · OH-1004

Nucleus0.224

Rank 3 · LXL04_005907 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_005907 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_005907 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase228-488 aa

PF07714.24PK_Tyr_Ser-Thr229-491 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005907	`PF00069.32`	Pkinase	228	488	4.3e-43	148.3
LXL04_005907	`PF07714.24`	PK_Tyr_Ser-Thr	229	491	1.4e-43	149.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXC8`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK2	52.617%	Swiss-Prot	moderate database homology
`Q8H1D6`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK1	45.739%	Swiss-Prot	moderate database homology
`Q5XF57`	Arabidopsis thaliana	Probable receptor-like serine/threonine-protein kinase At5g57670	47.115%	Swiss-Prot	moderate database homology
`Q9SX31`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK9	39.564%	Swiss-Prot	moderate database homology
`B5X4Z9`	Arabidopsis thaliana	Protein kinase STUNTED	40.830%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card