RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_005862
Reference: OH-1004 Chr: Chr01 Coordinates: 174727671-174728239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

459 bp · LXL04_005862|LXL04_005862|OH1004|cDNA

ATGGTGGAAGAATTGCTAAAGAACTATGATAATGTATGCACATTGCGAGTTAGAATGCCAATTTCTTCTGATTTAACGAACCCCCGAAACTTTATCACCAAAATCAGTCGTTATGAGAAAGTGGTCGACATTCCAAACTCCATGACTGTTCTTGACGAGCTTCTTCCAATCTCCATAGAAATGGCAAAGAGGAACCTCACTGGGATCTACAACTTCACAAACCCTGGTTGCATCAGCCATAACCAGATCTTGGAGATGTA...

CDS

Download CDS FASTA

459 bp · LXL04_005862|LXL04_005862|OH1004|CDS

ATGGTGGAAGAATTGCTAAAGAACTATGATAATGTATGCACATTGCGAGTTAGAATGCCAATTTCTTCTGATTTAACGAACCCCCGAAACTTTATCACCAAAATCAGTCGTTATGAGAAAGTGGTCGACATTCCAAACTCCATGACTGTTCTTGACGAGCTTCTTCCAATCTCCATAGAAATGGCAAAGAGGAACCTCACTGGGATCTACAACTTCACAAACCCTGGTTGCATCAGCCATAACCAGATCTTGGAGATGTA...

Protein

Download Protein FASTA

152 aa · LXL04_005862|LXL04_005862|OH1004|PROTEIN

MVEELLKNYDNVCTLRVRMPISSDLTNPRNFITKISRYEKVVDIPNSMTVLDELLPISIEMAKRNLTGIYNFTNPGCISHNQILEMYRDYIDPKFTWKNFNLEEQAKVIIAPRSNNELDTTKLKTEFPELLCIKDSLIKYVFEPNRKTIVKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_005862
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_005862
LocationChr01:174727671-174728239 (+)
DescriptionSimilar to NRS/ER: Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g63000 Bifunctional enzyme involved in dTDP-beta-L-rhamnose biosynthesis. No verified direct reference in this release
At1g78570 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058040
Overexpression of a cytosol-localized rhamnose biosynthesis protein encoded by Arabidopsis RHM1 gene increases rhamnose content in cell wall.2009 · DOI: 10.1016/j.plaphy.2008.10.011
At3g14790 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
At1g53500 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
RHM2 is involved in mucilage pectin synthesis and is required for the development of the seed coat in Arabidopsis.2004 · DOI: 10.1104/pp.103.034314
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005862 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006556 S-adenosylmethionine biosynthetic process Biological Process
GO:0010192 mucilage biosynthetic process Biological Process
GO:0010214 seed coat development Biological Process
GO:0010253 UDP-rhamnose biosynthetic process Biological Process
GO:0010315 auxin export across the plasma membrane Biological Process
GO:0019300 rhamnose biosynthetic process Biological Process
GO:0019305 dTDP-rhamnose biosynthetic process Biological Process
GO:0030154 cell differentiation Biological Process
GO:0042127 regulation of cell population proliferation Biological Process
GO:0051555 flavonol biosynthetic process Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G53500
ath:AT1G63000
ath:AT1G78570
ath:AT3G14790
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.567
Rank 1 · LXL04_005862 · OH-1004
Nucleus0.297
Rank 2 · LXL04_005862 · OH-1004
Endoplasmic reticulum0.106
Rank 3 · LXL04_005862 · OH-1004
Mitochondrion0.100
Rank 4 · LXL04_005862 · OH-1004
Lysosome / Vacuole0.083
Rank 5 · LXL04_005862 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LQ04Arabidopsis thalianaBifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase89.474%Swiss-Protstrong database homology
Q9SYM5Arabidopsis thalianaTrifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM183.108%Swiss-Protstrong database homology
Q9LH76Arabidopsis thalianaTrifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM381.081%Swiss-Protstrong database homology
Q9LPG6Arabidopsis thalianaTrifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM279.054%Swiss-Protstrong database homology

JBrowse

View in Genome Browser