LXL04_005799 | RubberDandelionOmics

Gene overview

LXL04_005799

Reference: OH-1004 Chr: Chr01 Coordinates: 173553978-173556907 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2154 bp · LXL04_005799|LXL04_005799|OH1004|cDNA

ATGGCGTGGAGGGAGCTTGGGAAAAAGAGCATTCGTGCTAGTCTTTCAAGGCTTCTGACTCCAACATCACACAGACATACATCTCCATGCAATTCATTCTCTAAACTACAGTTAAAATCTTCCTCACATTCACTTCAATGTATACAAGAATCCCGTCTTTTTCACACAACCCCACAACTACTGGGAAGAAGAGGAGACGATACAGTTGgtctacaaacacataaaaaAGGGAAATTCAAAAAAAGACCCGAAAATGCAAA...

CDS

Download CDS FASTA

2130 bp · LXL04_005799|LXL04_005799|OH1004|CDS

ATGGCGTGGAGGGAGCTTGGGAAAAAGAGCATTCGTGCTAGTCTTTCAAGGCTTCTGACTCCAACATCACACAGACATACATCTCCATGCAATTCATTCTCTAAACTACAGTTAAAATCTTCCTCACATTCACTTCAATGTATACAAGAATCCCGTCTTTTTCACACAACCCCACAACTACTGGGAAGAAGAGGAGACGATACAGTTGGTCTACAAACACATAAAAAAGGGAAATTCAAAAAAAGACCCGAAAATGCAAA...

Protein

Download Protein FASTA

709 aa · LXL04_005799|LXL04_005799|OH1004|PROTEIN

MAWRELGKKSIRASLSRLLTPTSHRHTSPCNSFSKLQLKSSSHSLQCIQESRLFHTTPQLLGRRGDDTVGLQTHKKGKFKKRPENAKPPVEAPYIPPKLKKPAKSSADKIVEIFEGMTTLELAQKCGQSVAMLQNILVNVGEKVGSEFDPLGIDIAELIAMEVGVNVKRLHSYEGTKVLPRAPVVTVMGHVDHGKTSLLDALRQTSVAAKEAGGITQHLGAFVVSMPSGASITFLDTPGHAAFSAMRARGAAVTDIVVLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005799`
TK1151 ID	TkA01G016320
OH-1004 ID	LXL04_005799
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 97.352 / OH-1004 67.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005799`
Location	Chr01:173553978-173556907 (+)
Description	Similar to infB: Translation initiation factor IF-2 (Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005799` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005829 cytosol Cellular Component GO:0003743 translation initiation factor activity Molecular Function GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function
KEGG gene cross-reference	csc:Csac_2070 gox:GOX1582 mpo:Mpop_2819 msl:Msil_2295 pla:Plav_3628 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.845

Rank 1 · LXL04_005799 · OH-1004

Plastid0.106

Rank 2 · LXL04_005799 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_005799 · OH-1004

Nucleus0.068

Rank 4 · LXL04_005799 · OH-1004

Cell membrane0.020

Rank 5 · LXL04_005799 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009.34GTP_EFTU184-341 aa

PF01926.30MMR_HSR1185-291 aa

PF22042.3EF-G_D2357-436 aa

PF11987.14IF-2485-579 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005799	`PF00009.34`	GTP_EFTU	184	341	5.2e-35	121.4
LXL04_005799	`PF01926.30`	MMR_HSR1	185	291	1.6e-09	38.6
LXL04_005799	`PF22042.3`	EF-G_D2	357	436	3.9e-20	72.5
LXL04_005799	`PF11987.14`	IF-2	485	579	1.5e-27	96.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card