LXL04_005766 | RubberDandelionOmics

Gene overview

LXL04_005766

Reference: OH-1004 Chr: Chr01 Coordinates: 173092601-173092900 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

198 bp · LXL04_005766|LXL04_005766|OH1004|cDNA

ATGGGTACAAGATTTCCAAGAAGCTATTATAAATGCTCATACAACAAGGTTGAGAAATGCATGGCTACTAAACAAGTAAAGAGAAGAGATGAAAATCCTAGAGTATTTGAGATTACATACAAAGGGATACACACCTGCAACAACAATGTCGCACGTACGGTCGGCACCACCATCACCATCTTTGCCGGAAAAGCATGA

CDS

Download CDS FASTA

198 bp · LXL04_005766|LXL04_005766|OH1004|CDS

ATGGGTACAAGATTTCCAAGAAGCTATTATAAATGCTCATACAACAAGGTTGAGAAATGCATGGCTACTAAACAAGTAAAGAGAAGAGATGAAAATCCTAGAGTATTTGAGATTACATACAAAGGGATACACACCTGCAACAACAATGTCGCACGTACGGTCGGCACCACCATCACCATCTTTGCCGGAAAAGCATGA

Protein

Download Protein FASTA

65 aa · LXL04_005766|LXL04_005766|OH1004|PROTEIN

MGTRFPRSYYKCSYNKVEKCMATKQVKRRDENPRVFEITYKGIHTCNNNVARTVGTTITIFAGKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005766`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005766

Location Chr01:173092601-173092900 (+)

Description Similar to WRKY30: Probable WRKY transcription factor 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24110`	Transcription factor.	No verified direct reference in this release
`At4g23810`	Transcription factor.	The antagonist function of Arabidopsis WRKY53 and ESR/ESP in leaf senescence is modulated by the jasmonic and salicylic acid equilibrium.2007 · DOI: 10.1105/tpc.106.042705 A HECT E3 ubiquitin ligase negatively regulates Arabidopsis leaf senescence through degradation of the transcription factor WRKY53.2010 · DOI: 10.1111/j.1365-313x.2010.04233.x Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003
`At4g11070`	Transcription factor.	No verified direct reference in this release
`At2g40740`	Transcription factor.	No verified direct reference in this release
`At2g46400`	Transcription factor involved in the regulation of osmotic stress responses and stomatal movement.	EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111 Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003 Transcription factor WRKY46 regulates osmotic stress responses and stomatal movement independently in Arabidopsis.2014 · DOI: 10.1111/tpj.12538 Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses.2017 · DOI: 10.1105/tpc.17.00364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010193 response to ozone Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0033198 response to ATP Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

KEGG gene cross-reference

ath:AT2G40740

ath:AT2G46400

ath:AT4G11070

ath:AT4G23810

ath:AT5G24110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.858

Rank 1 · LXL04_005766 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_005766 · OH-1004

Extracellular0.080

Rank 3 · LXL04_005766 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_005766 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_005766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY2-47 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005766	`PF03106.22`	WRKY	2	47	1.3e-15	58.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL62`	Arabidopsis thaliana	Probable WRKY transcription factor 30	53.333%	Swiss-Prot	strong database homology
`Q9SUP6`	Arabidopsis thaliana	Probable WRKY transcription factor 53	50.943%	Swiss-Prot	strong database homology
`Q8H0Y8`	Arabidopsis thaliana	Probable WRKY transcription factor 41	50.000%	Swiss-Prot	strong database homology
`Q9SHB5`	Arabidopsis thaliana	WRKY transcription factor 55	46.429%	Swiss-Prot	moderate database homology
`Q9SKD9`	Arabidopsis thaliana	Probable WRKY transcription factor 46	38.983%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card