LXL04_005747 | RubberDandelionOmics

Gene overview

LXL04_005747

Reference: OH-1004 Chr: Chr01 Coordinates: 172652592-172655879 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1602 bp · LXL04_005747|LXL04_005747|OH1004|cDNA

ATGGAGGTCTatgaacaaaaacaaaaaaagtttaGGCTTCTAAAGGCTAGAAGAGAAAGAGATAAATCATTTAGGTTTGCTCAATTAAAGCCCAACAATCAAAAAGCCCATAATCAGACCTGTATCATCACCTACCTCAACAATCAGACCATCGTTAGATTGAAACTACTTTTTACCCGCCAATTTCTTCTACGCACATCAATGGCGTCCATCGCATTTCGAATCTTGCAGTTCTTGATCTTCCCTGGTTCCATCATCTT...

CDS

Download CDS FASTA

1602 bp · LXL04_005747|LXL04_005747|OH1004|CDS

ATGGAGGTCTATGAACAAAAACAAAAAAAGTTTAGGCTTCTAAAGGCTAGAAGAGAAAGAGATAAATCATTTAGGTTTGCTCAATTAAAGCCCAACAATCAAAAAGCCCATAATCAGACCTGTATCATCACCTACCTCAACAATCAGACCATCGTTAGATTGAAACTACTTTTTACCCGCCAATTTCTTCTACGCACATCAATGGCGTCCATCGCATTTCGAATCTTGCAGTTCTTGATCTTCCCTGGTTCCATCATCTT...

Protein

Download Protein FASTA

533 aa · LXL04_005747|LXL04_005747|OH1004|PROTEIN

MEVYEQKQKKFRLLKARRERDKSFRFAQLKPNNQKAHNQTCIITYLNNQTIVRLKLLFTRQFLLRTSMASIAFRILQFLIFPGSIIFHFDSVIALQFNQDSDFSPLHFLFESPADSISPSPPPQTQSTVPRLSLSPYLPPESLPAPASPPHPSPSHSPPPSPPSSPPPPHPPPPSSTPSSKPPASTVNALFVLGDSSVDCGTNNFLGTFARADRLPYGRDFDTHQPTGRFCNGRIPVDYLALRLGLPFVPSYLGQSGAVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005747`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005747

Location Chr01:172652592-172655879 (-)

Description Similar to GLIP7: GDSL esterase/lipase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15720`	GDSL esterase/lipase 7.	No verified direct reference in this release
`At5g08460`	GDSL esterase/lipase At5g08460.	No verified direct reference in this release
`At1g71691`	GDSL esterase/lipase At1g71691.	No verified direct reference in this release
`At1g71250`	GDSL esterase/lipase At1g71250.	No verified direct reference in this release
`At1g29660`	Involved in EDS1-dependent systemic acquired resistance, maybe in phloem-mediated long-distance signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005747 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G29660

ath:AT1G71250

ath:AT1G71691

ath:AT5G08460

ath:AT5G15720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.345

Rank 1 · LXL04_005747 · OH-1004

Endoplasmic reticulum0.178

Rank 2 · LXL04_005747 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_005747 · OH-1004

Lysosome / Vacuole0.144

Rank 4 · LXL04_005747 · OH-1004

Cytoplasm0.113

Rank 5 · LXL04_005747 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL190-509 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005747	`PF00657.29`	Lipase_GDSL	190	509	1.3e-29	104.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFJ9`	Arabidopsis thaliana	GDSL esterase/lipase 7	39.329%	Swiss-Prot	moderate database homology
`Q9FNP2`	Arabidopsis thaliana	GDSL esterase/lipase At5g08460	35.569%	Swiss-Prot	moderate database homology
`Q9SF78`	Arabidopsis thaliana	GDSL esterase/lipase At1g71691	37.228%	Swiss-Prot	moderate database homology
`Q9FVV1`	Arabidopsis thaliana	GDSL esterase/lipase At1g71250	35.362%	Swiss-Prot	moderate database homology
`Q9C7N5`	Arabidopsis thaliana	GDSL esterase/lipase At1g29660	34.412%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card