Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1545 bp · LXL04_005745|LXL04_005745|OH1004|cDNA
ATGGAGATTTCGAGTTTCAGAAGCTTCACATTTGCAATTCTTGTCGCCATTTTAGTGTGGAGCTCAGCGATTCATCACACCTGCAATGCATCAAGAACTGGTCGGCATTGGAGGAAGAATCGAAGCACCTCCTCCACTTCGCTGTCCAAGAAGAAATCCGGCAACCACCACCACGGCGGTGGTGGCGGGAAATCGAAATCGAAATCTACTTCTCATAAAGCACCGCCGTCTGCTTCAAACCCTGCACCACCGGAACATGA...
1545 bp · LXL04_005745|LXL04_005745|OH1004|CDS
ATGGAGATTTCGAGTTTCAGAAGCTTCACATTTGCAATTCTTGTCGCCATTTTAGTGTGGAGCTCAGCGATTCATCACACCTGCAATGCATCAAGAACTGGTCGGCATTGGAGGAAGAATCGAAGCACCTCCTCCACTTCGCTGTCCAAGAAGAAATCCGGCAACCACCACCACGGCGGTGGTGGCGGGAAATCGAAATCGAAATCTACTTCTCATAAAGCACCGCCGTCTGCTTCAAACCCTGCACCACCGGAACATGA...
Protein
Download Protein FASTA514 aa · LXL04_005745|LXL04_005745|OH1004|PROTEIN
MEISSFRSFTFAILVAILVWSSAIHHTCNASRTGRHWRKNRSTSSTSLSKKKSGNHHHGGGGGKSKSKSTSHKAPPSASNPAPPEHDDNGGSPAAGNTYNVLNFGAKGDGSSDDTKAFEGAWAAACKVKGSKIIVPSPYTFLLGPITFSGPYCQQNIVFQIDGTIVAPSNFKSYGSGLFQWILFTKLVGLTIQGRGTIDGSGSIWWKNTPLNDPLDDELKLIFPINDTTPKIIHSSITDSLGGKMPSIKPTAVRFYGSID...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005745 |
|---|---|
| TK1151 ID | TkA01G019250 |
| OH-1004 ID | LXL04_005745 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005745 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:172601067-172604523 (+) | |||||||||
| Description | Similar to At1g48100: Polygalacturonase At1g48100 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0009830 cell wall modification involved in abscission Biological Process GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process GO:0009835 fruit ripening Biological Process GO:0009901 anther dehiscence Biological Process GO:0010047 fruit dehiscence Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0009501 amyloplast Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0004650 polygalacturonase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G48100 ath:AT1G80170 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00295.24Glyco_hydro_28129-210 aaPF00295.24Glyco_hydro_28248-466 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005745 | PF00295.24 | Glyco_hydro_28 | 129 | 210 | 1.1e-78 | 265.3 |
| LXL04_005745 | PF00295.24 | Glyco_hydro_28 | 248 | 466 | 1.1e-78 | 265.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.