LXL04_005683 | RubberDandelionOmics

Gene overview

LXL04_005683

Reference: OH-1004 Chr: Chr01 Coordinates: 170827481-170835520 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2418 bp · LXL04_005683|LXL04_005683|OH1004|cDNA

ATGAAGAAGAAGTATAGAATTGTTTGCATTGCATCCACCATCAAATTGGTGGATTGTTGCATATTTTATATGGAAAAAGTTAATGAAGATGCTAGCCTTGACTTTAAGTGGCTGGTAAAGAAAGGTGTTGGTGGGAAAAAGAAGGAGGTTCAGTTTTATGCATCTTTCATGTATGATGGAATGGAGTACATGTTATATGATTGTGTGTACATGTACAAGGAAGGTTTACGAGAGCCTTATATTGGCAAGATAACAAAAAT...

CDS

Download CDS FASTA

2418 bp · LXL04_005683|LXL04_005683|OH1004|CDS

ATGAAGAAGAAGTATAGAATTGTTTGCATTGCATCCACCATCAAATTGGTGGATTGTTGCATATTTTATATGGAAAAAGTTAATGAAGATGCTAGCCTTGACTTTAAGTGGCTGGTAAAGAAAGGTGTTGGTGGGAAAAAGAAGGAGGTTCAGTTTTATGCATCTTTCATGTATGATGGAATGGAGTACATGTTATATGATTGTGTGTACATGTACAAGGAAGGTTTACGAGAGCCTTATATTGGCAAGATAACAAAAAT...

Protein

Download Protein FASTA

805 aa · LXL04_005683|LXL04_005683|OH1004|PROTEIN

MKKKYRIVCIASTIKLVDCCIFYMEKVNEDASLDFKWLVKKGVGGKKKEVQFYASFMYDGMEYMLYDCVYMYKEGLREPYIGKITKIWENGDKTKKVKIHWFFRPEEISKWLGDTNTLENEILFASGEGVGLANISPLEAIAGKCNVVCISKDKRNPQPSNDELNAADFVFYRTFDVESCTISDNMGHEKIGGIEIEHIFNTRRENESINTLPQTLPTNNLKDDKQDSREKDLPNLADETAKSEKTISKIDEKDDKNKKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005683`
TK1151 ID	TkA01G023850
OH-1004 ID	LXL04_005683
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 97.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005683

Location Chr01:170827481-170835520 (+)

Description Similar to ASI1: Protein ANTI-SILENCING 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11470`	May regulate RNA processing, polyadenylation and epigenetic silencing.	Mechanism for full-length RNA processing of Arabidopsis genes containing intragenic heterochromatin.2013 · DOI: 10.1038/ncomms3301 RNA-binding protein regulates plant DNA methylation by controlling mRNA processing at the intronic heterochromatin-containing gene IBM1.2013 · DOI: 10.1073/pnas.1315399110 A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Genome-wide distribution and functions of the AAE complex in epigenetic regulation in Arabidopsis.2021 · DOI: 10.1111/jipb.13068 The arabidopsis GyraseB3 contributes to transposon silencing by promoting histone deacetylation.2025 · DOI: 10.1093/nar/gkaf985

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005683 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0141005 transposable element silencing by heterochromatin formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G11470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_005683 · OH-1004

Cytoplasm0.085

Rank 2 · LXL04_005683 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_005683 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_005683 · OH-1004

Mitochondrion0.011

Rank 5 · LXL04_005683 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426.25BAH63-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005683	`PF01426.25`	BAH	63	171	7.1e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYE3`	Arabidopsis thaliana	Protein ANTI-SILENCING 1	57.065%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card