LXL04_005681 | RubberDandelionOmics

Gene overview

LXL04_005681

Reference: OH-1004 Chr: Chr01 Coordinates: 170801659-170811213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5748 bp · LXL04_005681|LXL04_005681|OH1004|cDNA

ATGGCGTCAGGTAGTGCCTCACGCTCTCGCGTTGATCAGTTTTTTTCttcaaagaagaagaagaagcttGTTTCACCTTTTCCAAAATCAAAGATAATTGAAAAAGATGCAAAAGTTTTACTTGAAAAAAATTCTCCTAGTGCGAAGGGTTCTTTATCCAACTATTTAGTATCTTCACCaaatgacaaaaatacccctCAAAGGACTTTACCCACATCTTCAGTGTCATCTGATAGACAAGATCAAGTGAAAAGAAACCT...

CDS

Download CDS FASTA

5748 bp · LXL04_005681|LXL04_005681|OH1004|CDS

ATGGCGTCAGGTAGTGCCTCACGCTCTCGCGTTGATCAGTTTTTTTCTTCAAAGAAGAAGAAGAAGCTTGTTTCACCTTTTCCAAAATCAAAGATAATTGAAAAAGATGCAAAAGTTTTACTTGAAAAAAATTCTCCTAGTGCGAAGGGTTCTTTATCCAACTATTTAGTATCTTCACCAAATGACAAAAATACCCCTCAAAGGACTTTACCCACATCTTCAGTGTCATCTGATAGACAAGATCAAGTGAAAAGAAACCT...

Protein

Download Protein FASTA

1915 aa · LXL04_005681|LXL04_005681|OH1004|PROTEIN

MASGSASRSRVDQFFSSKKKKKLVSPFPKSKIIEKDAKVLLEKNSPSAKGSLSNYLVSSPNDKNTPQRTLPTSSVSSDRQDQVKRNLTSEINSSSRNENVENISSTQGHQCNLSESVHEVENPELQQFAANFLSFYCSDLPTTKDNTNKRQGSPSLLHLEDNSTKKRHITNVGDNSLSQFGLKKCNKTSPQSVDLTSSNTPNLEEVKLGNEKTPQSMHGSSMFSPGDTFWKEAIQVADDMSFHNKDHLHKQNLEESEGHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005681`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005681

Location Chr01:170801659-170811213 (-)

Description Similar to TEB: Helicase and polymerase-containing protein TEBICHI

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32700`	Required for regulated cell division and differentiation in meristems and embryos, thus modulating adaxial-abaxial polarity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005681 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0031297 replication fork processing Biological Process

GO:0042276 error-prone translesion synthesis Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT4G32700

hsa:10721

mmu:77782

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.684

Rank 1 · LXL04_005681 · OH-1004

Cytoplasm0.224

Rank 2 · LXL04_005681 · OH-1004

Mitochondrion0.081

Rank 3 · LXL04_005681 · OH-1004

Plastid0.079

Rank 4 · LXL04_005681 · OH-1004

Cell membrane0.035

Rank 5 · LXL04_005681 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD393-569 aa

PF00271.38Helicase_C708-783 aa

PF20470.5HTH_61788-879 aa

PF21099.3POLQ_helical903-1079 aa

PF25453.2DUF78981086-1159 aa

PF00476.27DNA_pol_A1504-1907 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005681	`PF00270.36`	DEAD	393	569	5.1e-20	72.6
LXL04_005681	`PF00271.38`	Helicase_C	708	783	4.3e-12	47.0
LXL04_005681	`PF20470.5`	HTH_61	788	879	3.4e-27	95.4
LXL04_005681	`PF21099.3`	POLQ_helical	903	1079	7.9e-54	182.8
LXL04_005681	`PF25453.2`	DUF7898	1086	1159	8.7e-07	30.0
LXL04_005681	`PF00476.27`	DNA_pol_A	1504	1907	7.1e-108	361.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q588V7`	Arabidopsis thaliana	Helicase and polymerase-containing protein TEBICHI	59.687%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card