LXL04_005680 | RubberDandelionOmics

Gene overview

LXL04_005680

Reference: OH-1004 Chr: Chr01 Coordinates: 170799210-170800555 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_005680|LXL04_005680|OH1004|cDNA

ATGGAGTTCCTCTACTTCTTATCCTTTATTTCTTTGGCAATGGTTGTGAGCCATGCAGCTGACGTGGCTCCTGAAACATACTGGAAATCTGTGTTGCCAAACACTCCCATGCCCAAAGCCTTCTTCAATCTCCTTCAAACCGATAAGAGCACCGATGTCCACGTAGGCGTTGGCAAAGGCGGCGTATCTGTCCATGCTCCTGGTACAAACGTCGGCGTCGGGAAAGGCGGTGTTTCTGTTCAAGCCCCCGGCACCACCGT...

CDS

Download CDS FASTA

1104 bp · LXL04_005680|LXL04_005680|OH1004|CDS

ATGGAGTTCCTCTACTTCTTATCCTTTATTTCTTTGGCAATGGTTGTGAGCCATGCAGCTGACGTGGCTCCTGAAACATACTGGAAATCTGTGTTGCCAAACACTCCCATGCCCAAAGCCTTCTTCAATCTCCTTCAAACCGATAAGAGCACCGATGTCCACGTAGGCGTTGGCAAAGGCGGCGTATCTGTCCATGCTCCTGGTACAAACGTCGGCGTCGGGAAAGGCGGTGTTTCTGTTCAAGCCCCCGGCACCACCGT...

Protein

Download Protein FASTA

367 aa · LXL04_005680|LXL04_005680|OH1004|PROTEIN

MEFLYFLSFISLAMVVSHAADVAPETYWKSVLPNTPMPKAFFNLLQTDKSTDVHVGVGKGGVSVHAPGTNVGVGKGGVSVQAPGTTVGVGKGGGHVSVHSPKSKPKGKCEEVYVGKGRIIVRCHDKGKGTHVEVSPFSYKYAATDDQLKDDPNVALFFLQKDLRDGNSMNLHFTETTTPSSNFLPRKVADAIPFSSEKLPELYTRFAVKPDTIESESMKKTISECEEKATEGEKRYCATSLEAMVDFSTSELGKNVNAIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005680`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005680

Location Chr01:170799210-170800555 (+)

Description Similar to RD22: BURP domain protein RD22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25610`	Acts to suppress chlorophyll degradation under moisture stress.	AtRD22 and AtUSPL1, members of the plant-specific BURP domain family involved in Arabidopsis thaliana drought tolerance.2014 · DOI: 10.1371/journal.pone.0110065

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0170900`	BURP domain-containing protein 17.	No verified direct reference in this release
`Os04g0225700`	BURP domain-containing protein 5.	No verified direct reference in this release
`Os05g0215066`	BURP domain-containing protein 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005680 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010152 pollen maturation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0043668 exine Cellular Component

GO:0070645 Ubisch body Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G25610

dosa:Os04g0225700

dosa:Os11g0170900

osa:4335212

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.412

Rank 1 · LXL04_005680 · OH-1004

Lysosome / Vacuole0.346

Rank 2 · LXL04_005680 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_005680 · OH-1004

Endoplasmic reticulum0.161

Rank 4 · LXL04_005680 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_005680 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03181.21BURP156-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005680	`PF03181.21`	BURP	156	366	2.1e-84	283.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08298`	Arabidopsis thaliana	BURP domain protein RD22	49.747%	Swiss-Prot	moderate database homology
`B9G9L9`	Oryza sativa subsp. japonica	BURP domain-containing protein 17	51.092%	Swiss-Prot	moderate database homology
`Q0JEP3`	Oryza sativa subsp. japonica	BURP domain-containing protein 5	46.721%	Swiss-Prot	moderate database homology
`Q6I5B2`	Oryza sativa subsp. japonica	BURP domain-containing protein 6	40.336%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card