LXL04_005577 | RubberDandelionOmics

Gene overview

LXL04_005577

Reference: OH-1004 Chr: Chr01 Coordinates: 168624052-168625134 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_005577|LXL04_005577|OH1004|cDNA

ATGGTCGAATCAATGGCGGCATCATCGTTGTTACGACCTACGCCAATTTTAGGGCATCATTGGACACAAAGACGACATTCTTCCGCTAAACATCTCGCAATGAACCCTAATTGGTTCTCCAAACTTCACCCAATCAAAGCTCAAGCAATCGAGCTAACCAGAGAGATATACAACTTCAAAGAAGAAGACAGATTCCAGGAAAAACCCGATAACACTAACCCACATAAAAAACCCATACCTTCATGGCCGCCAAACAACAA...

CDS

Download CDS FASTA

1083 bp · LXL04_005577|LXL04_005577|OH1004|CDS

ATGGTCGAATCAATGGCGGCATCATCGTTGTTACGACCTACGCCAATTTTAGGGCATCATTGGACACAAAGACGACATTCTTCCGCTAAACATCTCGCAATGAACCCTAATTGGTTCTCCAAACTTCACCCAATCAAAGCTCAAGCAATCGAGCTAACCAGAGAGATATACAACTTCAAAGAAGAAGACAGATTCCAGGAAAAACCCGATAACACTAACCCACATAAAAAACCCATACCTTCATGGCCGCCAAACAACAA...

Protein

Download Protein FASTA

360 aa · LXL04_005577|LXL04_005577|OH1004|PROTEIN

MVESMAASSLLRPTPILGHHWTQRRHSSAKHLAMNPNWFSKLHPIKAQAIELTREIYNFKEEDRFQEKPDNTNPHKKPIPSWPPNNKADNKSLQNPLQRQHQMGCGWLAAIFEWEGVLIEDNPDLEQQSWLTLSQEESKSPPPTFILKRIQGMKNEQAISEVLCWSRDPSQLSRMSSRKEEIHKSLQSGIFRFRDGSREFVNTLTRHNIPMALVSTRPRKNLEEAIGAIGINGVFNVVVTCEDVYRGKPDPEMFMYAAQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005577`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005577

Location Chr01:168624052-168625134 (+)

Description Similar to PYRP2: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11570`	Catalyzes dephosphorylation of 5-amino-6-(5-phospho-D-ribitylamino)uracil but has no activity toward flavin mononucleotide.	Identification and characterization of the missing phosphatase on the riboflavin biosynthesis pathway in Arabidopsis thaliana.2016 · DOI: 10.1111/tpj.13291

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005577 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0017000 antibiotic biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0008801 beta-phosphoglucomutase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043726 5-amino-6-(5-phosphoribitylamino)uracil phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT4G11570

bsu:BSU09240

bsu:BSU34550

tma:TM1254

tmi:THEMA_08065

tmm:Tmari_1259

tmw:THMA_1279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · LXL04_005577 · OH-1004

Nucleus0.039

Rank 2 · LXL04_005577 · OH-1004

Mitochondrion0.031

Rank 3 · LXL04_005577 · OH-1004

Cytoplasm0.022

Rank 4 · LXL04_005577 · OH-1004

Cell membrane0.019

Rank 5 · LXL04_005577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13419.13HAD_2111-291 aa

PF00702.33Hydrolase194-284 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005577	`PF13419.13`	HAD_2	111	291	2.5e-20	73.9
LXL04_005577	`PF00702.33`	Hydrolase	194	284	6.9e-15	56.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDD5`	Arabidopsis thaliana	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic	67.516%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card