Gene Card
Gene overview
cDNA / CDS / Protein Sequences
792 bp · LXL04_005549|LXL04_005549|OH1004|cDNA
atgtcacacGGTGTGGTCTCCATTGAAGCCACCAAAGCCAAGCAAACCACCGAACCCATAACGTGCGGTGTCGACATCAAGGTGAACCTATCTCGTGTGGTTTCATTTCCTTCTTCATCCCGGTTCTTCAATGGGTTCACGAACCCAAGCTTCAACCGGGGTGAAGAAGGAAATGAGACCACACGAGATGGGTTCACCTTAATGTCGACACCGCATGTTATGGGTTCGGTGGTTTGCTTGGCTTCGTTGGCTTCAATAGA...
792 bp · LXL04_005549|LXL04_005549|OH1004|CDS
ATGTCACACGGTGTGGTCTCCATTGAAGCCACCAAAGCCAAGCAAACCACCGAACCCATAACGTGCGGTGTCGACATCAAGGTGAACCTATCTCGTGTGGTTTCATTTCCTTCTTCATCCCGGTTCTTCAATGGGTTCACGAACCCAAGCTTCAACCGGGGTGAAGAAGGAAATGAGACCACACGAGATGGGTTCACCTTAATGTCGACACCGCATGTTATGGGTTCGGTGGTTTGCTTGGCTTCGTTGGCTTCAATAGA...
Protein
Download Protein FASTA263 aa · LXL04_005549|LXL04_005549|OH1004|PROTEIN
MSHGVVSIEATKAKQTTEPITCGVDIKVNLSRVVSFPSSSRFFNGFTNPSFNRGEEGNETTRDGFTLMSTPHVMGSVVCLASLASIETTPRTLSLYTNTNKHKHFQTQMENRLLWASMKRRKGKGAEEQQPESMVVLCNTKLPQFLVLNRLHHQALKNPKHAIDKVLDPTNKQTYLDQGSSTKLGVIVLIGRWDDGIFQFPVQMAEEIANGDTLFECSGPIRDKSNDEKLWEALMTMQCDDMDLMWLIGVHVQIIKTSLF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005549 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005549 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr01:168224005-168228998 (+) | ||||||
| Description | Protein of unknown function | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000256 allantoin catabolic process Biological Process GO:0006145 purine nucleobase catabolic process Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0010136 ureide catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0004038 allantoinase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0050897 cobalt ion binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT4G04955 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94AP0 | Arabidopsis thaliana | Allantoinase | 66.667% | Swiss-Prot | weak database homology |