LXL04_005337 | RubberDandelionOmics

Gene overview

LXL04_005337

Reference: OH-1004 Chr: Chr01 Coordinates: 160894497-160897237 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · LXL04_005337|LXL04_005337|OH1004|cDNA

ATGGGGTTTTTTAATAGATTAAAGATTTTACTTCTGCTATCGGTTTCAATTTCATATTTGATTCTTGAAATCGCCGACGGATATTATCTTCCCGGTAGCTATCCCCATAAATACGACGTGGGTGATCGATTATCTGTAAAAGTCAACTCACTAACATCAATAGATACAGAAATTCCATATGGGTATTACTCTTTACCCTTCTGTAAGCCTCTCGAAGGCATAAAAGATAAAGCGGAAAACATCGGCGAGCTTCTAATGGG...

CDS

Download CDS FASTA

1977 bp · LXL04_005337|LXL04_005337|OH1004|CDS

ATGGGGTTTTTTAATAGATTAAAGATTTTACTTCTGCTATCGGTTTCAATTTCATATTTGATTCTTGAAATCGCCGACGGATATTATCTTCCCGGTAGCTATCCCCATAAATACGACGTGGGTGATCGATTATCTGTAAAAGTCAACTCACTAACATCAATAGATACAGAAATTCCATATGGGTATTACTCTTTACCCTTCTGTAAGCCTCTCGAAGGCATAAAAGATAAAGCGGAAAACATCGGCGAGCTTCTAATGGG...

Protein

Download Protein FASTA

658 aa · LXL04_005337|LXL04_005337|OH1004|PROTEIN

MGFFNRLKILLLLSVSISYLILEIADGYYLPGSYPHKYDVGDRLSVKVNSLTSIDTEIPYGYYSLPFCKPLEGIKDKAENIGELLMGDRIENSPYRFKMFKNETEIVLCKSNPLSSDEFKTLRERIDEMYQVNLNLDNLPAIRYTRKDGYFLRWTGYPVGIKVKDVYYVFNHLKFTVLAHKHEHNNVVGVIGTGDGAELITRGNDTNNDGYMVVGFEVQPCSVNHDVSLLQDIKPYGKYSKSIICNPASVAMAVSEGRSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005337`
TK1151 ID	TkA01G064180
OH-1004 ID	LXL04_005337
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005337

Location Chr01:160894497-160897237 (+)

Description Similar to TMN11: Transmembrane 9 superfamily member 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35160`	Transmembrane 9 superfamily member 11.	No verified direct reference in this release
`At4g12650`	Transmembrane 9 superfamily member 12.	No verified direct reference in this release
`At3g13772`	May play a role as effector of cellular copper homeostasis.	Transmembrane nine proteins in yeast and Arabidopsis affect cellular metal contents without changing vacuolar morphology.2010 · DOI: 10.1111/j.1399-3054.2010.01404.x
`At5g25100`	Transmembrane 9 superfamily member 9.	No verified direct reference in this release
`At1g55130`	Transmembrane 9 superfamily member 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0072657 protein localization to membrane Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G55130

ath:AT3G13772

ath:AT4G12650

ath:AT5G25100

ath:AT5G35160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.323

Rank 1 · LXL04_005337 · OH-1004

Endoplasmic reticulum0.317

Rank 2 · LXL04_005337 · OH-1004

Lysosome / Vacuole0.246

Rank 3 · LXL04_005337 · OH-1004

Cytoplasm0.144

Rank 4 · LXL04_005337 · OH-1004

Cell membrane0.089

Rank 5 · LXL04_005337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02990.22EMP7059-610 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005337	`PF02990.22`	EMP70	59	610	2e-176	588.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYQ8`	Arabidopsis thaliana	Transmembrane 9 superfamily member 11	72.162%	Swiss-Prot	strong database homology
`F4JRE0`	Arabidopsis thaliana	Transmembrane 9 superfamily member 12	63.125%	Swiss-Prot	strong database homology
`Q9LIC2`	Arabidopsis thaliana	Transmembrane 9 superfamily member 7	41.385%	Swiss-Prot	moderate database homology
`Q9C5N2`	Arabidopsis thaliana	Transmembrane 9 superfamily member 9	40.969%	Swiss-Prot	moderate database homology
`Q9C720`	Arabidopsis thaliana	Transmembrane 9 superfamily member 6	40.746%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card