LXL04_005281 | RubberDandelionOmics

Gene overview

LXL04_005281

Reference: OH-1004 Chr: Chr01 Coordinates: 159649364-159650564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · LXL04_005281|LXL04_005281|OH1004|cDNA

ATGGAAATTTGTGGTGTCGATGAGCAAGAAAACCATAAAAGTACTGGTTTTGATGCACCAGGTACTACTGTGATGACGAGCACCGATGATCAGAGAGGGATCTGGGAGATTGATGTAAGAGCTCAACAACAAAATCTGCTTCACGAAATGAACGATCCTTCGATGTTTTACAACGATCAATTTCCTCAGATTCCTGATTTTCCATGCATGtcttcttcatcgtcttcttcGTCGAATCCTGCACCTGCTAAGCCGATTTC...

CDS

Download CDS FASTA

837 bp · LXL04_005281|LXL04_005281|OH1004|CDS

ATGGAAATTTGTGGTGTCGATGAGCAAGAAAACCATAAAAGTACTGGTTTTGATGCACCAGGTACTACTGTGATGACGAGCACCGATGATCAGAGAGGGATCTGGGAGATTGATGTAAGAGCTCAACAACAAAATCTGCTTCACGAAATGAACGATCCTTCGATGTTTTACAACGATCAATTTCCTCAGATTCCTGATTTTCCATGCATGTCTTCTTCATCGTCTTCTTCGTCGAATCCTGCACCTGCTAAGCCGATTTC...

Protein

Download Protein FASTA

278 aa · LXL04_005281|LXL04_005281|OH1004|PROTEIN

MEICGVDEQENHKSTGFDAPGTTVMTSTDDQRGIWEIDVRAQQQNLLHEMNDPSMFYNDQFPQIPDFPCMSSSSSSSSNPAPAKPISSATTTSSASSGSSSTSSAASWAVLKSEYVTEEEAEGDEELRINRRKRSHREEPVPVMTTAPAVEAVPPLDKADGSGTIDCMDVMEDFGYMDLIDGNEIWDPSSIFEQNPPDLQQECVTATRGYSNGSEEGNKKQKTGCHCLMSHCMHKLCSCLKAGVACSNLCQCDGCRNVNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005281`
TK1151 ID	TkA01G070250
OH-1004 ID	LXL04_005281
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 54.783 / OH-1004 22.662 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005281

Location Chr01:159649364-159650564 (+)

Description Similar to ABI3: B3 domain-containing transcription factor ABI3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24650`	Participates in abscisic acid-regulated gene expression during seed development.	A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 ABI3 controls embryo degreening through Mendel's I locus.2013 · DOI: 10.1073/pnas.1308114110
`At3g22780`	Probable floral-specific cell division component, required for proper organ formation in flowers.	Regulation of meristem organization and cell division by TSO1, an Arabidopsis gene with cysteine-rich repeats.2000 · DOI: 10.1242/dev.127.10.2207 TSO1 is a novel protein that modulates cytokinesis and cell expansion in Arabidopsis.2000 · DOI: 10.1242/dev.127.10.2219 TSO1 functions in cell division during Arabidopsis flower development.1997 · DOI: 10.1242/dev.124.3.665 Arabidopsis TSO1 regulates directional processes in cells during floral organogenesis.1998 · DOI: 10.1093/genetics/150.1.411
`At4g14770`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At3g22760`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At5g25790`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009657 plastid organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010235 guard mother cell cytokinesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0010481 epidermal cell division Biological Process

KEGG gene cross-reference

ath:AT3G22760

ath:AT3G22780

ath:AT3G24650

ath:AT4G14770

ath:AT5G25790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_005281 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_005281 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_005281 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_005281 · OH-1004

Mitochondrion0.010

Rank 5 · LXL04_005281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03638.22TCR223-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005281	`PF03638.22`	TCR	223	257	2e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q01593`	Arabidopsis thaliana	B3 domain-containing transcription factor ABI3	40.291%	Swiss-Prot	moderate database homology
`Q9LUI3`	Arabidopsis thaliana	CRC domain-containing protein TSO1	51.163%	Swiss-Prot	weak database homology
`F4JIF5`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 2	44.681%	Swiss-Prot	weak database homology
`Q8L548`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 3	46.512%	Swiss-Prot	weak database homology
`F4JY84`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 7	32.468%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card