LXL04_005249 | RubberDandelionOmics

Gene overview

LXL04_005249

Reference: OH-1004 Chr: Chr01 Coordinates: 158895869-158898343 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_005249|LXL04_005249|OH1004|cDNA

ATGAGTTCGTCAGTTAGAGCTTTTGGTGCAATTTTCTACAGATTCTCAACTGGGGTTCCCCTCAGGTCCCCCAATTCCTTCCCTATTCAAGGGGCTGTTATGTTAAACAAGAATCTATCATCTTCATCATTATACTCATCGTGTGCAAAATGGGTTACGCCACTTGAGTTCCAATCTGTGAATGCTGTCAGAAAGATTTGGACTCGCGGTCCTCTCTGTATGGGAAGAAGGTCCTGCAAAATTGCAGGCAGGAAGGGCGC...

CDS

Download CDS FASTA

993 bp · LXL04_005249|LXL04_005249|OH1004|CDS

ATGAGTTCGTCAGTTAGAGCTTTTGGTGCAATTTTCTACAGATTCTCAACTGGGGTTCCCCTCAGGTCCCCCAATTCCTTCCCTATTCAAGGGGCTGTTATGTTAAACAAGAATCTATCATCTTCATCATTATACTCATCGTGTGCAAAATGGGTTACGCCACTTGAGTTCCAATCTGTGAATGCTGTCAGAAAGATTTGGACTCGCGGTCCTCTCTGTATGGGAAGAAGGTCCTGCAAAATTGCAGGCAGGAAGGGCGC...

Protein

Download Protein FASTA

330 aa · LXL04_005249|LXL04_005249|OH1004|PROTEIN

MSSSVRAFGAIFYRFSTGVPLRSPNSFPIQGAVMLNKNLSSSSLYSSCAKWVTPLEFQSVNAVRKIWTRGPLCMGRRSCKIAGRKGAQDAKKAKLYAKVGKEVVSAQLTLHKNSVKKGGPNPTSNTTLAAILEKAKQLDIPKEILERNIKRASDKNQEAYIEKIYEVYGYGGVGIILEVSTDKINRSVALVREVVKDCGGKMADPGSIMFKFRRARVVNVKVTDVDKDMLLSIALDSGADDVIEPFIDEDDTEEDDKSER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005249`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005249

Location Chr01:158895869-158898343 (-)

Description Similar to At2g25830: Probable transcriptional regulatory protein At2g25830

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25830`	Probable transcriptional regulatory protein At2g25830.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005249 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G25830

cmu:TC_0742

cta:CTA_0499

ctb:CTL0717

ctl:CTLon_0713

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.852

Rank 1 · LXL04_005249 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_005249 · OH-1004

Plastid0.050

Rank 3 · LXL04_005249 · OH-1004

Nucleus0.050

Rank 4 · LXL04_005249 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_005249 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20772.3TACO1_YebC_N77-154 aa

PF01709.27Transcrip_reg160-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005249	`PF20772.3`	TACO1_YebC_N	77	154	9.9e-18	65.1
LXL04_005249	`PF01709.27`	Transcrip_reg	160	328	3.3e-35	121.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82314`	Arabidopsis thaliana	Probable transcriptional regulatory protein At2g25830	62.651%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card