LXL04_005204 | RubberDandelionOmics

Gene overview

LXL04_005204

Reference: OH-1004 Chr: Chr01 Coordinates: 157727656-157729965 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_005204|LXL04_005204|OH1004|cDNA

ATGCAGACTCCAAAAATAAGCGTAAAGAGCACCGAAAGTGGTAGGAGGATCTCTCCTAGATCTGTTTCTTTGGAAACTAAACAAAGGAGTAGTGGTCGTGTTGTTCGACAACTAAAGACAAGTGGCCTTGAAGTCAACTTTTCTTCAACTAGTACACCAAAAGCAACAAGTGCTAAAATCGTTCATCGTACATCACCAAGAGGCCTTGATCTtgagAAAAAGCGTCCAGGAAGAGTCGCCGAACTTGAAACCCAGATTAG...

CDS

Download CDS FASTA

1419 bp · LXL04_005204|LXL04_005204|OH1004|CDS

ATGCAGACTCCAAAAATAAGCGTAAAGAGCACCGAAAGTGGTAGGAGGATCTCTCCTAGATCTGTTTCTTTGGAAACTAAACAAAGGAGTAGTGGTCGTGTTGTTCGACAACTAAAGACAAGTGGCCTTGAAGTCAACTTTTCTTCAACTAGTACACCAAAAGCAACAAGTGCTAAAATCGTTCATCGTACATCACCAAGAGGCCTTGATCTTGAGAAAAAGCGTCCAGGAAGAGTCGCCGAACTTGAAACCCAGATTAG...

Protein

Download Protein FASTA

472 aa · LXL04_005204|LXL04_005204|OH1004|PROTEIN

MQTPKISVKSTESGRRISPRSVSLETKQRSSGRVVRQLKTSGLEVNFSSTSTPKATSAKIVHRTSPRGLDLEKKRPGRVAELETQISQLEDALRTVKDQLIVSESWKKQAKLDAEESRKELLAITSRLEESQKLLPPSSSSSNENHSNYQSEEIRVLKESLAEKVSLIEEMKNTLDDCRSSESQAQALASETLQQLETARKTMESLKLTNDGYNGIVSELDQSKERVSSLESIIEEMKVNEKQRESDEITALKSELENMR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005204`
TK1151 ID	TkA01G076120
OH-1004 ID	LXL04_005204
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005204

Location Chr01:157727656-157729965 (+)

Description Similar to ICR3: Interactor of constitutive active ROPs 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60210`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At2g37080`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At3g53350`	ROP effector binding specifically activated ROPs and linking them to the microtubule cytoskeleton.	Rho of plant GTPase signaling regulates the behavior of Arabidopsis kinesin-13A to establish secondary cell wall patterns.2013 · DOI: 10.1105/tpc.113.117853
`At1g78430`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At1g17140`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	RIP1 (ROP Interactive Partner 1)/ICR1 marks pollen germination sites and may act in the ROP1 pathway in the control of polarized pollen growth.2008 · DOI: 10.1093/mp/ssn051

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005204 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G17140

ath:AT1G78430

ath:AT2G37080

ath:AT3G53350

ath:AT5G60210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · LXL04_005204 · OH-1004

Nucleus0.297

Rank 2 · LXL04_005204 · OH-1004

Cell membrane0.255

Rank 3 · LXL04_005204 · OH-1004

Plastid0.049

Rank 4 · LXL04_005204 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_005204 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27682.1ICR5_C269-312 aa

PF27682.1ICR5_C321-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005204	`PF27682.1`	ICR5_C	269	312	9.3e-18	65.7
LXL04_005204	`PF27682.1`	ICR5_C	321	405	9.3e-18	65.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSS5`	Arabidopsis thaliana	Interactor of constitutive active ROPs 3	32.770%	Swiss-Prot	moderate database homology
`Q9ZQC5`	Arabidopsis thaliana	Interactor of constitutive active ROPs 2, chloroplastic	31.188%	Swiss-Prot	moderate database homology
`Q8VYU8`	Arabidopsis thaliana	Interactor of constitutive active ROPs 5	27.545%	Swiss-Prot	weak database homology
`Q9M9F9`	Arabidopsis thaliana	Interactor of constitutive active ROPs 4	32.184%	Swiss-Prot	weak database homology
`Q8LE98`	Arabidopsis thaliana	Interactor of constitutive active ROPs 1	31.429%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card