Gene Card
Gene overview
cDNA / CDS / Protein Sequences
426 bp · LXL04_005151|LXL04_005151|OH1004|cDNA
ATGGGTTTTTACTTTTTATCATTTCTCATTGAAATCACTGTTTCAATTCTCATTAAGTTAGAAGTGATAGTTAAGGCTTTGAAATGGCTTCAGATGAATATGGATTTGGATGAGGTGGAATGCATACTGTCGATTTTAATATACACGAATATGGTGAAAGGGTACTTTGGTCACAAGTGCAAAGTGGCAGTTTTAAGCAAACATGATCCATTCCCCAAACATTTTTGCAACATTTTTAGTCAGAGATTGATAAACTATTG...
426 bp · LXL04_005151|LXL04_005151|OH1004|CDS
ATGGGTTTTTACTTTTTATCATTTCTCATTGAAATCACTGTTTCAATTCTCATTAAGTTAGAAGTGATAGTTAAGGCTTTGAAATGGCTTCAGATGAATATGGATTTGGATGAGGTGGAATGCATACTGTCGATTTTAATATACACGAATATGGTGAAAGGGTACTTTGGTCACAAGTGCAAAGTGGCAGTTTTAAGCAAACATGATCCATTCCCCAAACATTTTTGCAACATTTTTAGTCAGAGATTGATAAACTATTG...
Protein
Download Protein FASTA141 aa · LXL04_005151|LXL04_005151|OH1004|PROTEIN
MGFYFLSFLIEITVSILIKLEVIVKALKWLQMNMDLDEVECILSILIYTNMVKGYFGHKCKVAVLSKHDPFPKHFCNIFSQRLINYWLFMHPTQSLQNSTLCIIGSVISQIPRHSFILCDRKETAIPCKYSFLSFHMYCTL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005151 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005151 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr01:156575206-156575887 (+) | ||||||
| Description | Similar to EER5: Enhanced ethylene response protein 5 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0009723 response to ethylene Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0015031 protein transport Biological Process GO:0016973 poly(A)+ mRNA export from nucleus Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048364 root development Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component | ||||||
| KEGG gene cross-reference | ath:AT2G19560 ddi:DDB_G0284241 hsa:55795 mmu:234069 xla:734284 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q8GWE6 | Arabidopsis thaliana | Enhanced ethylene response protein 5 | 73.214% | Swiss-Prot | weak database homology |