LXL04_005144 | RubberDandelionOmics

Gene overview

LXL04_005144

Reference: OH-1004 Chr: Chr01 Coordinates: 156215881-156216939 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_005144|LXL04_005144|OH1004|cDNA

ATGAGCAATGGAGGTGGAGTAGATGACACCGAGTTCGATGAAAAGAAAATACGGGTAGCCGCTGACGAATTCGGCAGAGCTGTAGCGAAAGTAGCGGTAGCTCAGATATGCGAGCGTGCTGGTTTCCAGAGTGTTAACGATTCTGCTCTTGAGTCTCTAGCCGATATCGCTATCAGGTACGTGAGAGATTTAGGGAAAACTGCAAAGTTTTACGCTAACGTAGCCAATAGAACCGAGTGCAATGTGTTCGACGTGATTCA...

CDS

Download CDS FASTA

1059 bp · LXL04_005144|LXL04_005144|OH1004|CDS

ATGAGCAATGGAGGTGGAGTAGATGACACCGAGTTCGATGAAAAGAAAATACGGGTAGCCGCTGACGAATTCGGCAGAGCTGTAGCGAAAGTAGCGGTAGCTCAGATATGCGAGCGTGCTGGTTTCCAGAGTGTTAACGATTCTGCTCTTGAGTCTCTAGCCGATATCGCTATCAGGTACGTGAGAGATTTAGGGAAAACTGCAAAGTTTTACGCTAACGTAGCCAATAGAACCGAGTGCAATGTGTTCGACGTGATTCA...

Protein

Download Protein FASTA

352 aa · LXL04_005144|LXL04_005144|OH1004|PROTEIN

MSNGGGVDDTEFDEKKIRVAADEFGRAVAKVAVAQICERAGFQSVNDSALESLADIAIRYVRDLGKTAKFYANVANRTECNVFDVIQSLEDSGSSIGFPGGSETCTSLSRSTAMKEIMEYVEAIEELPFAQPVPTFPVVRDRRLTPSFLQMGETPESKHVPDWLPAFPDPHTYIHSAVWNERTSDPRSDKVELARQRRKAENSLLTLQKRLLSDSSSSPPTSTSEVTNGSKKTRFGEKPVTLSNNHTNAVNLENHVSIME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005144`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005144

Location Chr01:156215881-156216939 (+)

Description Similar to TAF8: Transcription initiation factor TFIID subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34340`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005144 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001112 DNA-templated transcription open complex formation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042789 mRNA transcription by RNA polymerase II Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0051457 maintenance of protein location in nucleus Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G34340

bta:539938

hsa:129685

mmu:63856

xla:380201

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_005144 · OH-1004

Cytoplasm0.069

Rank 2 · LXL04_005144 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_005144 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_005144 · OH-1004

Plastid0.011

Rank 5 · LXL04_005144 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07524.20Bromo_TP23-93 aa

PF10406.15TAF8_C159-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005144	`PF07524.20`	Bromo_TP	23	93	3.6e-23	82.1
LXL04_005144	`PF10406.15`	TAF8_C	159	207	4.5e-19	69.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYZ9`	Arabidopsis thaliana	Transcription initiation factor TFIID subunit 8	43.881%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card