LXL04_004896 | RubberDandelionOmics

Gene overview

LXL04_004896

Reference: OH-1004 Chr: Chr01 Coordinates: 149789568-149791747 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · LXL04_004896|LXL04_004896|OH1004|cDNA

ATGTACTTAGAGCATCAACACTTATCTGCAGCTCATTTCCTGTGCATCAAGTTCATAGAGCGTAGATCATCTCAGATCACAACAATGACTCCACCAATTGAAACTGAAATCAAAACCACCAACTCTCATCACTACTCACACGCTCCTCTCAACGAAAGAATACTTTCATCCATGAGAAGAAGATCAGTCGCTGCCCATCCATGGCATGATCTCGAAATAGGACCAGGAGCACCAACAATCTTCAACTGCGTGATTGAGAT...

CDS

Download CDS FASTA

735 bp · LXL04_004896|LXL04_004896|OH1004|CDS

ATGTACTTAGAGCATCAACACTTATCTGCAGCTCATTTCCTGTGCATCAAGTTCATAGAGCGTAGATCATCTCAGATCACAACAATGACTCCACCAATTGAAACTGAAATCAAAACCACCAACTCTCATCACTACTCACACGCTCCTCTCAACGAAAGAATACTTTCATCCATGAGAAGAAGATCAGTCGCTGCCCATCCATGGCATGATCTCGAAATAGGACCAGGAGCACCAACAATCTTCAACTGCGTGATTGAGAT...

Protein

Download Protein FASTA

244 aa · LXL04_004896|LXL04_004896|OH1004|PROTEIN

MYLEHQHLSAAHFLCIKFIERRSSQITTMTPPIETEIKTTNSHHYSHAPLNERILSSMRRRSVAAHPWHDLEIGPGAPTIFNCVIEISKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPILPGCFLRAKAIGVMPMIDQGEKDDKIIAVCADDPEYRHFNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPAGEAIEVVRHSMDLYADYIVESLRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004896`
TK1151 ID	TkA01G098700
OH-1004 ID	LXL04_004896
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 88.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004896

Location Chr01:149789568-149791747 (-)

Description Similar to PPA4: Soluble inorganic pyrophosphatase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53620`	Catalyzes the irreversible hydrolysis of pyrophosphate (PPi) to phosphate.	No verified direct reference in this release
`At1g01050`	Catalyzes the irreversible hydrolysis of pyrophosphate (PPi) to phosphate.	Oil and protein accumulation in developing seeds is influenced by the expression of a cytosolic pyrophosphatase in Arabidopsis.2012 · DOI: 10.1104/pp.112.198309
`At4g01480`	Soluble inorganic pyrophosphatase 5.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0704900`	Soluble inorganic pyrophosphatase.	No verified direct reference in this release
`UniProt: A2X8Q3`	Soluble inorganic pyrophosphatase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004896 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0006796 phosphate-containing compound metabolic process Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0019915 lipid storage Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004427 inorganic diphosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01050

ath:AT3G53620

ath:AT4G01480

dosa:Os02g0704900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · LXL04_004896 · OH-1004

Nucleus0.324

Rank 2 · LXL04_004896 · OH-1004

Cell membrane0.127

Rank 3 · LXL04_004896 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_004896 · OH-1004

Lysosome / Vacuole0.059

Rank 5 · LXL04_004896 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00719.25Pyrophosphatase83-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004896	`PF00719.25`	Pyrophosphatase	83	234	5.9e-60	202.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFF9`	Arabidopsis thaliana	Soluble inorganic pyrophosphatase 4	82.407%	Swiss-Prot	strong database homology
`Q93V56`	Arabidopsis thaliana	Soluble inorganic pyrophosphatase 1	85.641%	Swiss-Prot	strong database homology
`O82597`	Arabidopsis thaliana	Soluble inorganic pyrophosphatase 5	80.660%	Swiss-Prot	strong database homology
`Q0DYB1`	Oryza sativa subsp. japonica	Soluble inorganic pyrophosphatase	78.199%	Swiss-Prot	strong database homology
`A2X8Q3`	Oryza sativa subsp. indica	Soluble inorganic pyrophosphatase	78.199%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card