LXL04_004842 | RubberDandelionOmics

Gene overview

LXL04_004842

Reference: OH-1004 Chr: Chr01 Coordinates: 148544407-148545591 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · LXL04_004842|LXL04_004842|OH1004|cDNA

ATGGCGGGAGTTCGAAGCAAGATGTTCGTCGTGCTACTTTGCTCCGCTTTTCTGATTGCACCCTTCGCTGACGCCATAGATGTCAAATACTGCAATAAGAAGAACAGTTACGATGTGAAGGTGAGTGGAGTTGAGATCACCCCTTCCCCAATAACAAGAGACGTAGATACCACCTTCACCATTTCTGCAACTACAGATACACCTATCCCTGGAGGGAGCCTTCAAATCGATGTTTCATACTACTTTTTTGGTGTCTACAG...

CDS

Download CDS FASTA

474 bp · LXL04_004842|LXL04_004842|OH1004|CDS

ATGGCGGGAGTTCGAAGCAAGATGTTCGTCGTGCTACTTTGCTCCGCTTTTCTGATTGCACCCTTCGCTGACGCCATAGATGTCAAATACTGCAATAAGAAGAACAGTTACGATGTGAAGGTGAGTGGAGTTGAGATCACCCCTTCCCCAATAACAAGAGACGTAGATACCACCTTCACCATTTCTGCAACTACAGATACACCTATCCCTGGAGGGAGCCTTCAAATCGATGTTTCATACTACTTTTTTGGTGTCTACAG...

Protein

Download Protein FASTA

157 aa · LXL04_004842|LXL04_004842|OH1004|PROTEIN

MAGVRSKMFVVLLCSAFLIAPFADAIDVKYCNKKNSYDVKVSGVEITPSPITRDVDTTFTISATTDTPIPGGSLQIDVSYYFFGVYSETSDLCTKTSCPVDAGEFEISHTQSLPSVTPPGSYTLTMKLKDANKKELTCITFDFSIGWYASEAQLAAM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004842`
TK1151 ID	TkA01G102400
OH-1004 ID	LXL04_004842
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004842

Location Chr01:148544407-148545591 (+)

Description Similar to DDB_G0282179: Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16005`	Involved in the regulation of gravitropic response and basipetal auxin transport in roots.	ROSY1, a novel regulator of gravitropic response is a stigmasterol binding protein.2016 · DOI: 10.1016/j.jplph.2016.03.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004842 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0015918 sterol transport Biological Process

GO:0032366 intracellular sterol transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008429 phosphatidylethanolamine binding Molecular Function

GO:0032934 sterol binding Molecular Function

KEGG gene cross-reference

ago:AGOS_AER201C

ath:AT2G16005

ddi:DDB_G0278295

ddi:DDB_G0282179

kla:KLLA0_E13311g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.437

Rank 1 · LXL04_004842 · OH-1004

Extracellular0.269

Rank 2 · LXL04_004842 · OH-1004

Endoplasmic reticulum0.160

Rank 3 · LXL04_004842 · OH-1004

Cytoplasm0.156

Rank 4 · LXL04_004842 · OH-1004

Golgi apparatus0.107

Rank 5 · LXL04_004842 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02221.21E1_DerP2_DerF226-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004842	`PF02221.21`	E1_DerP2_DerF2	26	145	1.3e-23	84.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9AST8`	Arabidopsis thaliana	MD-2-related lipid-recognition protein ROSY1	29.231%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card