LXL04_004829 | RubberDandelionOmics

Gene overview

LXL04_004829

Reference: OH-1004 Chr: Chr01 Coordinates: 148264787-148266540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_004829|LXL04_004829|OH1004|cDNA

ATGGAAGAGAATTTCATGTCCACGTTCCCGAGGAAAACGGAAGATCAAAATACAAGGATTGGTGACCGAGATACAAGTGATGTAGTCGCAAGACTAAGAACACCTGAAGGCCGTGATGAATGGCTATACTGCCATTCCCACATTCTCACAAAAAAGAGCAAATATTTTGCAGACCGTTTATCCGAAACCTGGCCCACATGTCAGATTCTTGATTCCCGCAATTGTGTTGAAGTCCATTGCCAAGAACACAATTTTGACCA...

CDS

Download CDS FASTA

1287 bp · LXL04_004829|LXL04_004829|OH1004|CDS

ATGGAAGAGAATTTCATGTCCACGTTCCCGAGGAAAACGGAAGATCAAAATACAAGGATTGGTGACCGAGATACAAGTGATGTAGTCGCAAGACTAAGAACACCTGAAGGCCGTGATGAATGGCTATACTGCCATTCCCACATTCTCACAAAAAAGAGCAAATATTTTGCAGACCGTTTATCCGAAACCTGGCCCACATGTCAGATTCTTGATTCCCGCAATTGTGTTGAAGTCCATTGCCAAGAACACAATTTTGACCA...

Protein

Download Protein FASTA

428 aa · LXL04_004829|LXL04_004829|OH1004|PROTEIN

MEENFMSTFPRKTEDQNTRIGDRDTSDVVARLRTPEGRDEWLYCHSHILTKKSKYFADRLSETWPTCQILDSRNCVEVHCQEHNFDHHITVLRLFYLSVTDICHNVKNALGILQVAVNLGCPEITTTCVDFLEASPWEEAEEEEILKVIPAIGMLAEPILSRLQPVNPPAVTKTFLSATRFATSALPLSMSDLKTSAQEQIEYMLTEDDDAPLIITSDESIKSKVRQYFKGLLTRFENVVKMEMEMDLFQSFLSDMSWAC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004829`
TK1151 ID	TkA01G103380
OH-1004 ID	LXL04_004829
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004829

Location Chr01:148264787-148266540 (-)

Description Similar to At3g05675: BTB/POZ domain-containing protein At3g05675

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05675`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g63850`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50780`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g60050`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g13690`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004829 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G63850

ath:AT2G13690

ath:AT3G05675

ath:AT3G50780

ath:AT5G60050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.524

Rank 1 · LXL04_004829 · OH-1004

Cytoplasm0.425

Rank 2 · LXL04_004829 · OH-1004

Cell membrane0.100

Rank 3 · LXL04_004829 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_004829 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_004829 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB26-134 aa

PF25553.2BTB-POZ_ANK-like254-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004829	`PF00651.38`	BTB	26	134	6.1e-06	27.1
LXL04_004829	`PF25553.2`	BTB-POZ_ANK-like	254	409	1.2e-06	28.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RX01`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g05675	58.486%	Swiss-Prot	strong database homology
`Q9CAJ9`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g63850	23.798%	Swiss-Prot	weak database homology
`Q9SVM0`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g50780	24.882%	Swiss-Prot	weak database homology
`Q9LVG9`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g60050	21.106%	Swiss-Prot	weak database homology
`Q9SKH2`	Arabidopsis thaliana	BTB/POZ domain-containing protein At2g13690	20.809%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card