LXL04_004784 | RubberDandelionOmics

Gene overview

LXL04_004784

Reference: OH-1004 Chr: Chr01 Coordinates: 145893861-145895425 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · LXL04_004784|LXL04_004784|OH1004|cDNA

ATGATACTCGAAAGGTACAAAATGGGGAATTCTTCACAAAATGAAAATGTATGTGAATGTATTCAAATAACTGCTTTAAACCTTCGATTAACATCTTCAACAGCTCTTGTAATCGAACAAATATCTATTAAAAACCTTTTAATTCAACTTCGTGAAAAAGATAATAAACAACAAAAGAAGCAGATTCTGAGAATCCTTTTGGACGTGCTGAAAAATCATGGCAATTTATTTACATCAGTGAATGTAGACAACCATAGCAT...

CDS

Download CDS FASTA

681 bp · LXL04_004784|LXL04_004784|OH1004|CDS

ATGATACTCGAAAGGTACAAAATGGGGAATTCTTCACAAAATGAAAATGTATGTGAATGTATTCAAATAACTGCTTTAAACCTTCGATTAACATCTTCAACAGCTCTTGTAATCGAACAAATATCTATTAAAAACCTTTTAATTCAACTTCGTGAAAAAGATAATAAACAACAAAAGAAGCAGATTCTGAGAATCCTTTTGGACGTGCTGAAAAATCATGGCAATTTATTTACATCAGTGAATGTAGACAACCATAGCAT...

Protein

Download Protein FASTA

226 aa · LXL04_004784|LXL04_004784|OH1004|PROTEIN

MILERYKMGNSSQNENVCECIQITALNLRLTSSTALVIEQISIKNLLIQLREKDNKQQKKQILRILLDVLKNHGNLFTSVNVDNHSIAQKKEYRSQRVDSYVNREEPPKSITGIPPEECKCLISCKVMYDSVVIDSGERIKDRRRAVFETEEFGVSILQDLHQQRQTLLNSLAKRYLASFEILYDTILEAMLKLDEKIKEATKKFPINPKINDWRPIYNDFFGLNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004784`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004784

Location Chr01:145893861-145895425 (-)

Description Similar to VTI13: Vesicle transport v-SNARE 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29100`	May function as a v-SNARE responsible for targeting vesicles involved in the secretory pathway (By similarity).	SNARE VTI13 plays a unique role in endosomal trafficking pathways associated with the vacuole and is essential for cell wall organization and root hair growth in arabidopsis.2014 · DOI: 10.1093/aob/mcu041
`At5g39510`	Functions as a v-SNARE responsible for targeting AtELP-containing vesicles from the trans-Golgi network (TGN) to the prevacuolar compartment (PVC) and mediates liposome fusion.	The plant vesicle-associated SNARE AtVTI1a likely mediates vesicle transport from the trans-Golgi network to the prevacuolar compartment.1999 · DOI: 10.1091/mbc.10.7.2251 SGR2, a phospholipase-like protein, and ZIG/SGR4, a SNARE, are involved in the shoot gravitropism of Arabidopsis.2002 · DOI: 10.1105/tpc.010215 Involvement of the vacuoles of the endodermis in the early process of shoot gravitropism in Arabidopsis.2002 · DOI: 10.1105/tpc.010216 Conversion of functional specificity in Qb-SNARE VTI1 homologues of Arabidopsis.2005 · DOI: 10.1016/j.cub.2005.02.021 Divergent functions of VTI12 and VTI11 in trafficking to storage and lytic vacuoles in Arabidopsis.2007 · DOI: 10.1073/pnas.0611147104 The occurrence of 'bulbs', a complex configuration of the vacuolar membrane, is affected by mutations of vacuolar SNARE and phospholipase in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04665.x Functional redundancy between trans-Golgi network SNARE family members in Arabidopsis thaliana.2013 · DOI: 10.1186/1471-2091-14-22 Mutations in the SGR4, SGR5 and SGR6 loci of Arabidopsis thaliana alter the shoot gravitropism.1997 · DOI: 10.1093/oxfordjournals.pcp.a029201
`At1g26670`	Together with either SYP41 or SYP61, required for membrane fusion; the fusion of phospholipid vesicles containing SYP41 or SYP61 and VTI12 is triggered by YKT61 and YKT62.	Conversion of functional specificity in Qb-SNARE VTI1 homologues of Arabidopsis.2005 · DOI: 10.1016/j.cub.2005.02.021 YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.2005 · DOI: 10.1016/j.jmb.2005.04.061 Divergent functions of VTI12 and VTI11 in trafficking to storage and lytic vacuoles in Arabidopsis.2007 · DOI: 10.1073/pnas.0611147104 Functional redundancy between trans-Golgi network SNARE family members in Arabidopsis thaliana.2013 · DOI: 10.1186/1471-2091-14-22

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004784 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0009630 gravitropism Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0051222 positive regulation of protein transport Biological Process

GO:0075733 intracellular transport of virus Biological Process

GO:0080147 root hair cell development Biological Process

GO:0080171 lytic vacuole organization Biological Process

GO:1990019 protein storage vacuole organization Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G26670

ath:AT3G29100

ath:AT5G39510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.522

Rank 1 · LXL04_004784 · OH-1004

Cytoplasm0.395

Rank 2 · LXL04_004784 · OH-1004

Mitochondrion0.084

Rank 3 · LXL04_004784 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_004784 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_004784 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12352.14V-SNARE_C136-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004784	`PF12352.14`	V-SNARE_C	136	174	1.6e-07	32.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVP9`	Arabidopsis thaliana	Vesicle transport v-SNARE 13	70.588%	Swiss-Prot	weak database homology
`Q9SEL6`	Arabidopsis thaliana	Vesicle transport v-SNARE 11	67.647%	Swiss-Prot	weak database homology
`Q9SEL5`	Arabidopsis thaliana	Vesicle transport v-SNARE 12	61.111%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card