LXL04_004754 | RubberDandelionOmics

Gene overview

LXL04_004754

Reference: OH-1004 Chr: Chr01 Coordinates: 145403107-145406507 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · LXL04_004754|LXL04_004754|OH1004|cDNA

ATGCCACAACTTCGAAGTGGAGCAAGGAGATCAAAACGGCTCGGTGATCTTCAGCCCGCCactcaacaacaacaacaacaacaacctCCCAATCAACCTGAAACCACAACTCCAAACAGACCTAGAAGAAAaaccggtggtggtggtggaagggGACGTGGTGGTGGTGATGCTGCAGGTGTAGCCAAAACGCCAGTGGCGGCATTACCAGTGAGGCCAACTGTTGGTGGTAGAGGTAGAGGTGTTAGGCTGATTGATTT...

CDS

Download CDS FASTA

2127 bp · LXL04_004754|LXL04_004754|OH1004|CDS

ATGCCACAACTTCGAAGTGGAGCAAGGAGATCAAAACGGCTCGGTGATCTTCAGCCCGCCACTCAACAACAACAACAACAACAACCTCCCAATCAACCTGAAACCACAACTCCAAACAGACCTAGAAGAAAAACCGGTGGTGGTGGTGGAAGGGGACGTGGTGGTGGTGATGCTGCAGGTGTAGCCAAAACGCCAGTGGCGGCATTACCAGTGAGGCCAACTGTTGGTGGTAGAGGTAGAGGTGTTAGGCTGATTGATTT...

Protein

Download Protein FASTA

708 aa · LXL04_004754|LXL04_004754|OH1004|PROTEIN

MPQLRSGARRSKRLGDLQPATQQQQQQQPPNQPETTTPNRPRRKTGGGGGRGRGGGDAAGVAKTPVAALPVRPTVGGRGRGVRLIDLDPEQPCDNIAPEAPIRIDTFADKDTPMEGGSGADKAMGVEEEGNTTPVPERVQVGSSPIYKTERKLGKGGFGQVYVGRRVSGGTERTGPDAIEVALKFEHRNSKGCNYGPPYEWQVYSSLNGCYGIPWVHYKGRQGDFYIMVMDILGPSLWDVWNSLGQSMSPSMVACIAVES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004754`
TK1151 ID	TkA01G115460
OH-1004 ID	LXL04_004754
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004754

Location Chr01:145403107-145406507 (-)

Description Similar to HD16: Casein kinase 1-like protein HD16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0793500`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.2013 · DOI: 10.1111/tpj.12268

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004754 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006897 endocytosis Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007165 signal transduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0030111 regulation of Wnt signaling pathway Biological Process

GO:0030177 positive regulation of Wnt signaling pathway Biological Process

KEGG gene cross-reference

dosa:Os03g0793500

hsa:1453

pon:100172245

rno:64462

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · LXL04_004754 · OH-1004

Nucleus0.457

Rank 2 · LXL04_004754 · OH-1004

Cell membrane0.116

Rank 3 · LXL04_004754 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_004754 · OH-1004

Mitochondrion0.063

Rank 5 · LXL04_004754 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase147-379 aa

PF07714.24PK_Tyr_Ser-Thr148-383 aa

PF17667.8Pkinase_fungal259-357 aa

PF24289.2DUF7477441-707 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004754	`PF00069.32`	Pkinase	147	379	9.9e-17	61.9
LXL04_004754	`PF07714.24`	PK_Tyr_Ser-Thr	148	383	1e-06	29.0
LXL04_004754	`PF17667.8`	Pkinase_fungal	259	357	2e-08	34.1
LXL04_004754	`PF24289.2`	DUF7477	441	707	5.3e-161	534.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q852L0`	Oryza sativa subsp. japonica	Casein kinase 1-like protein HD16	75.895%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card