LXL04_004721 | RubberDandelionOmics

Gene overview

LXL04_004721

Reference: OH-1004 Chr: Chr01 Coordinates: 144699152-144700118 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · LXL04_004721|LXL04_004721|OH1004|cDNA

ATGGGGTTAGTCAAATTAGCGGTTGGTGATGGCGTCTTAACTTTCCTGTGGGTATTCTGTGCTTCCTGCCTTAGTGCCGGAACTTCCATTATTGCTAAAGCAATCGGCGTTCAAGGAATAGCTACAAGGTTGATCACGATTACACTCGTCTTCATCCTTTTGTTCTGTTTCGGTATAATGGGTAGCGTCTTAGGTGGCGCTAGTTTTAACCCTACTGGTACTGCTGCCTTTTACGCCGTCGGCCATGGTGGCGATACTCT...

CDS

Download CDS FASTA

711 bp · LXL04_004721|LXL04_004721|OH1004|CDS

ATGGGGTTAGTCAAATTAGCGGTTGGTGATGGCGTCTTAACTTTCCTGTGGGTATTCTGTGCTTCCTGCCTTAGTGCCGGAACTTCCATTATTGCTAAAGCAATCGGCGTTCAAGGAATAGCTACAAGGTTGATCACGATTACACTCGTCTTCATCCTTTTGTTCTGTTTCGGTATAATGGGTAGCGTCTTAGGTGGCGCTAGTTTTAACCCTACTGGTACTGCTGCCTTTTACGCCGTCGGCCATGGTGGCGATACTCT...

Protein

Download Protein FASTA

236 aa · LXL04_004721|LXL04_004721|OH1004|PROTEIN

MGLVKLAVGDGVLTFLWVFCASCLSAGTSIIAKAIGVQGIATRLITITLVFILLFCFGIMGSVLGGASFNPTGTAAFYAVGHGGDTLISAAVRFPAQAVGAVGGALAIVKFMPSEYKHMIGGPYCKVDMHTCAIVEGMLTFTSSILVLYVILRGPKSWIMKNWLLSASIVTLVGFGRAYTGPSMNPANAFGWAYVNNHYTTWKHLYVYWISPFIGAITAGWTFRLIFPPPSKQKVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004721`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004721

Location Chr01:144699152-144700118 (+)

Description Similar to SIP1-1: Aquaporin SIP1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04090`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release
`At5g18290`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0182200`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004721 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT3G04090

ath:AT5G18290

dosa:Os01g0182200

zma:541892

zma:542494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.560

Rank 1 · LXL04_004721 · OH-1004

Cell membrane0.200

Rank 2 · LXL04_004721 · OH-1004

Lysosome / Vacuole0.106

Rank 3 · LXL04_004721 · OH-1004

Cytoplasm0.099

Rank 4 · LXL04_004721 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_004721 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP11-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004721	`PF00230.26`	MIP	11	222	5.6e-15	56.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8W5`	Arabidopsis thaliana	Aquaporin SIP1-1	49.782%	Swiss-Prot	moderate database homology
`Q9FK43`	Arabidopsis thaliana	Probable aquaporin SIP1-2	46.914%	Swiss-Prot	moderate database homology
`Q5VR89`	Oryza sativa subsp. japonica	Aquaporin SIP1-1	54.338%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card