LXL04_004714 | RubberDandelionOmics

Gene overview

LXL04_004714

Reference: OH-1004 Chr: Chr01 Coordinates: 144425871-144426791 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · LXL04_004714|LXL04_004714|OH1004|cDNA

ATGCATCTACTTTATGAGGCTGAAATTGAAATTGTAATTCTATGTAAGCAAACAGTGTACATTTTTGGATGCAAAGATTCAGTTCTTCAAATTAAAGGGAAAGTTAACAACATAACTGTTGACAAATGCACAAAAATGGGTGTTGTATTCACGGATGTTTTTGCTGCTTGCGAAATTGTCAATTGTAATAGTGTTGAGGTCCAATGCCAGGGTACAGCCCCTACTATTTCAGTGGACAACTTAGCAGGTTGTCAGCTGTA...

CDS

Download CDS FASTA

435 bp · LXL04_004714|LXL04_004714|OH1004|CDS

ATGCATCTACTTTATGAGGCTGAAATTGAAATTGTAATTCTATGTAAGCAAACAGTGTACATTTTTGGATGCAAAGATTCAGTTCTTCAAATTAAAGGGAAAGTTAACAACATAACTGTTGACAAATGCACAAAAATGGGTGTTGTATTCACGGATGTTTTTGCTGCTTGCGAAATTGTCAATTGTAATAGTGTTGAGGTCCAATGCCAGGGTACAGCCCCTACTATTTCAGTGGACAACTTAGCAGGTTGTCAGCTGTA...

Protein

Download Protein FASTA

144 aa · LXL04_004714|LXL04_004714|OH1004|PROTEIN

MHLLYEAEIEIVILCKQTVYIFGCKDSVLQIKGKVNNITVDKCTKMGVVFTDVFAACEIVNCNSVEVQCQGTAPTISVDNLAGCQLYLSKDSLEASITTAKSNEINVLVPGPDNDMVEHTVPQQYIHSFKDGQFLTTPVSHSGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004714`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004714

Location Chr01:144425871-144426791 (-)

Description Similar to CAP1: Cyclase-associated protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34490`	Actin monomer binding protein that accelerates the exchange of ADP for ATP.	Arabidopsis CAP regulates the actin cytoskeleton necessary for plant cell elongation and division.2002 · DOI: 10.1105/tpc.010301 Identification of Arabidopsis cyclase-associated protein 1 as the first nucleotide exchange factor for plant actin.2007 · DOI: 10.1091/mbc.e06-11-1041 Arabidopsis CAP1 - a key regulator of actin organisation and development.2007 · DOI: 10.1242/jcs.007302

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004714 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000902 cell morphogenesis Biological Process

GO:0006907 pinocytosis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0033298 contractile vacuole organization Biological Process

GO:0098609 cell-cell adhesion Biological Process

KEGG gene cross-reference

ath:AT4G34490

bta:504519

ddi:DDB_G0288769

mmu:67252

rno:116653

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · LXL04_004714 · OH-1004

Nucleus0.356

Rank 2 · LXL04_004714 · OH-1004

Extracellular0.136

Rank 3 · LXL04_004714 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_004714 · OH-1004

Cell membrane0.062

Rank 5 · LXL04_004714 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08603.17CAP_C8-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004714	`PF08603.17`	CAP_C	8	141	1.2e-49	168.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65902`	Arabidopsis thaliana	Cyclase-associated protein 1	77.692%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card