LXL04_004666 | RubberDandelionOmics

Gene overview

LXL04_004666

Reference: OH-1004 Chr: Chr01 Coordinates: 142883933-142888275 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1479 bp · LXL04_004666|LXL04_004666|OH1004|cDNA

ATGGAGCTGGGTAGCATTGTTGATTTTTTCGACAACAAAGTCGTATTAATAACTGGTGCTACTGGTTTTCTTGCCAAAAtttttatgGAGAAAATACTAAGAGTTCAACCAAATGTGAAGAAACTCTATCTTCTTATTAGAGCCCCTGATGCCGAATCTGCCTTGCAACGCTTCCAGACTGAGGCAGTAGCAAAGGACTTGTTTAAGCTCCTGAAAGAGAAACATGGAGAAAACCTGCAAAAGTTCTTGACCGAAAAAGT...

CDS

Download CDS FASTA

1479 bp · LXL04_004666|LXL04_004666|OH1004|CDS

ATGGAGCTGGGTAGCATTGTTGATTTTTTCGACAACAAAGTCGTATTAATAACTGGTGCTACTGGTTTTCTTGCCAAAATTTTTATGGAGAAAATACTAAGAGTTCAACCAAATGTGAAGAAACTCTATCTTCTTATTAGAGCCCCTGATGCCGAATCTGCCTTGCAACGCTTCCAGACTGAGGCAGTAGCAAAGGACTTGTTTAAGCTCCTGAAAGAGAAACATGGAGAAAACCTGCAAAAGTTCTTGACCGAAAAAGT...

Protein

Download Protein FASTA

492 aa · LXL04_004666|LXL04_004666|OH1004|PROTEIN

MELGSIVDFFDNKVVLITGATGFLAKIFMEKILRVQPNVKKLYLLIRAPDAESALQRFQTEAVAKDLFKLLKEKHGENLQKFLTEKVAPVAGDIIFEDMGIQDSSLKAEMWRDVDIVVNVAASTNFDERYDVALPLNTLGAKNVLNFAKKCVNIKLFLHVSTAYVSGEKPGLILETPYYLGKSLNGTSGVDIDQERKVLEDKLKELKYDHNANEKSIKLAMKELGMERANHNGWPNTYVFTKAMGEMIVGQLRGDMPVVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004666`
TK1151 ID	TkA01G126370
OH-1004 ID	LXL04_004666
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 55.285 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004666

Location Chr01:142883933-142888275 (-)

Description Similar to Alcohol-forming fatty acyl-CoA reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33790`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	CER4 encodes an alcohol-forming fatty acyl-coenzyme A reductase involved in cuticular wax production in Arabidopsis.2006 · DOI: 10.1104/pp.106.086785
`At5g22500`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.2010 · DOI: 10.1104/pp.110.158238 Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822
`At3g44540`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.2010 · DOI: 10.1104/pp.110.158238 Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822
`At3g44550`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.2010 · DOI: 10.1104/pp.110.158238 Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822 Identification of amino acids conferring chain length substrate specificities on fatty alcohol-forming reductases FAR5 and FAR8 from Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m113.499715

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004666 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0080019 alcohol-forming very long-chain fatty acyl-CoA reductase activity Molecular Function

GO:0102965 alcohol-forming long-chain fatty acyl-CoA reductase activity Molecular Function

KEGG gene cross-reference

ag:AAD38039

ath:AT3G44540

ath:AT3G44550

ath:AT4G33790

ath:AT5G22500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.396

Rank 1 · LXL04_004666 · OH-1004

Peroxisome0.176

Rank 2 · LXL04_004666 · OH-1004

Cytoplasm0.137

Rank 3 · LXL04_004666 · OH-1004

Mitochondrion0.100

Rank 4 · LXL04_004666 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_004666 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370.28Epimerase15-171 aa

PF07993.19NAD_binding_417-319 aa

PF03015.25Sterile394-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004666	`PF01370.28`	Epimerase	15	171	1.3e-09	38.6
LXL04_004666	`PF07993.19`	NAD_binding_4	17	319	4.7e-75	252.8
LXL04_004666	`PF03015.25`	Sterile	394	486	1.1e-14	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZB9`	Arabidopsis thaliana	Fatty acyl-CoA reductase 3	56.212%	Swiss-Prot	strong database homology
`Q39152`	Arabidopsis thaliana	Fatty acyl-CoA reductase 1	51.633%	Swiss-Prot	strong database homology
`Q9LXN3`	Arabidopsis thaliana	Probable fatty acyl-CoA reductase 4	51.935%	Swiss-Prot	strong database homology
`Q0WRB0`	Arabidopsis thaliana	Probable fatty acyl-CoA reductase 5	51.710%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card