LXL04_004521 | RubberDandelionOmics

Gene overview

LXL04_004521

Reference: OH-1004 Chr: Chr01 Coordinates: 139116175-139121625 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3243 bp · LXL04_004521|LXL04_004521|OH1004|cDNA

ATGACCAACATTCTGGTTTTCATCATCTTCCTTGCGATCATATTGGGGATAAAATCGCCGGGGCCGTTAAGTCATCTGGCCACCGCCCAACAGTACCCTGATCCGGAAACCCTGAAGAAAGATCCCGCCAAATTACAAGAGGCCACAAAATCCATCTATACTCGATTCAATTCGCTATCCTCACTTTTCCATGAAGATGCCATGGATGATTTTAGCTTCTGCATGAAAAACATAACTGCCGAGTGGAATGAAGCTTTTGA...

CDS

Download CDS FASTA

3243 bp · LXL04_004521|LXL04_004521|OH1004|CDS

ATGACCAACATTCTGGTTTTCATCATCTTCCTTGCGATCATATTGGGGATAAAATCGCCGGGGCCGTTAAGTCATCTGGCCACCGCCCAACAGTACCCTGATCCGGAAACCCTGAAGAAAGATCCCGCCAAATTACAAGAGGCCACAAAATCCATCTATACTCGATTCAATTCGCTATCCTCACTTTTCCATGAAGATGCCATGGATGATTTTAGCTTCTGCATGAAAAACATAACTGCCGAGTGGAATGAAGCTTTTGA...

Protein

Download Protein FASTA

1080 aa · LXL04_004521|LXL04_004521|OH1004|PROTEIN

MTNILVFIIFLAIILGIKSPGPLSHLATAQQYPDPETLKKDPAKLQEATKSIYTRFNSLSSLFHEDAMDDFSFCMKNITAEWNEAFDFSSDTKFLSNCIQKTNGNILQRLCTAADIKFYVTVLSEAERQGFKITNYIKGNKNCNLKSWVSGCEPGWACSVEKDTEVDLKNKEEIPFRTTDCEPCCEGFFCPTGLTCMIPCPSGSYCPLARLNPKTNMCDPYRYQPPPGENNHSCGGADVWAAVVNSREVFCPAGFFCPSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004521`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004521

Location Chr01:139116175-139121625 (+)

Description Similar to ABCG28: ABC transporter G family member 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60740`	ABC transporter G family member 28.	No verified direct reference in this release
`At2g37010`	Putative white-brown complex homolog protein 30.	No verified direct reference in this release
`At1g53390`	ABC transporter G family member 24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B9G5Y5`	ABC transporter G family member 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015846 polyamine transport Biological Process

GO:0015878 biotin transport Biological Process

GO:0032218 riboflavin transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0097744 renal urate salt excretion Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53390

ath:AT2G37010

ath:AT5G60740

dosa:Os10g0442900

mcc:574307

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.760

Rank 1 · LXL04_004521 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_004521 · OH-1004

Endoplasmic reticulum0.095

Rank 3 · LXL04_004521 · OH-1004

Lysosome / Vacuole0.066

Rank 4 · LXL04_004521 · OH-1004

Golgi apparatus0.061

Rank 5 · LXL04_004521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran498-648 aa

PF19055.7ABC2_membrane_7677-1080 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004521	`PF00005.34`	ABC_tran	498	648	3.3e-26	93.2
LXL04_004521	`PF19055.7`	ABC2_membrane_7	677	1080	2.5e-191	636.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF46`	Arabidopsis thaliana	ABC transporter G family member 28	60.409%	Swiss-Prot	strong database homology
`Q9SJK6`	Arabidopsis thaliana	Putative white-brown complex homolog protein 30	58.879%	Swiss-Prot	strong database homology
`Q9MAG3`	Arabidopsis thaliana	ABC transporter G family member 24	55.305%	Swiss-Prot	strong database homology
`B9G5Y5`	Oryza sativa subsp. japonica	ABC transporter G family member 25	48.549%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card