LXL04_004508 | RubberDandelionOmics

Gene overview

LXL04_004508

Reference: OH-1004 Chr: Chr01 Coordinates: 138820300-138823384 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_004508|LXL04_004508|OH1004|cDNA

ATGCCATCCAAACCATGTGTGTCGTCTCAAGAAGGCTCTTTGTGGTATTCACCTACGGCCTCCTTGGTTCATCACTCGGTAAAAACTGAACTTGCTATTAAAGATTTAGGCAAATTAAGTTACTTCCTTAGTTTTGAAGTTTCTTATACGCCTTATGGCTTGTTCCTTAGCCAAAGTAAATATGCTCATGACATTCTAAGTCGGGTCAGCCTCCTTGGTTCAAAACTTGTTGGAGCACCTCTTGCAAGTAACAACACCTT...

CDS

Download CDS FASTA

948 bp · LXL04_004508|LXL04_004508|OH1004|CDS

ATGCCATCCAAACCATGTGTGTCGTCTCAAGAAGGCTCTTTGTGGTATTCACCTACGGCCTCCTTGGTTCATCACTCGGTAAAAACTGAACTTGCTATTAAAGATTTAGGCAAATTAAGTTACTTCCTTAGTTTTGAAGTTTCTTATACGCCTTATGGCTTGTTCCTTAGCCAAAGTAAATATGCTCATGACATTCTAAGTCGGGTCAGCCTCCTTGGTTCAAAACTTGTTGGAGCACCTCTTGCAAGTAACAACACCTT...

Protein

Download Protein FASTA

315 aa · LXL04_004508|LXL04_004508|OH1004|PROTEIN

MPSKPCVSSQEGSLWYSPTASLVHHSVKTELAIKDLGKLSYFLSFEVSYTPYGLFLSQSKYAHDILSRVSLLGSKLVGAPLASNNTFTTSDTPFHDSSLYRSFVGALQYLTITRPDFSYVVNQASQFIHSPTDQHFTLVKRIMRYVKGTLTHGLQFSCPTKFMLICYSNPDWPCCIETRPFHLRLLDLLGGPTLLCNNLSAIFLSQIPVAHRRAKHIDIHLHFVREVILSGKLRTKFVPTKLQGEEFKHKSHTEEDIASS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004508`
TK1151 ID	TkA03G615480
OH-1004 ID	LXL04_004508
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.700
Protein coverage (%)	TK1151 72.321 / OH-1004 25.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004508

Location Chr01:138820300-138823384 (-)

Description Similar to AtMg00810: Uncharacterized mitochondrial protein AtMg00810

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004508 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0042025 host cell nucleus Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.599

Rank 1 · LXL04_004508 · OH-1004

Nucleus0.371

Rank 2 · LXL04_004508 · OH-1004

Plastid0.090

Rank 3 · LXL04_004508 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_004508 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_004508 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92519`	Arabidopsis thaliana	Uncharacterized mitochondrial protein AtMg00810	41.379%	Swiss-Prot	moderate database homology
`Q9ZT94`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE2	41.216%	Swiss-Prot	weak database homology
`Q94HW2`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE1	40.385%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card