LXL04_004450 | RubberDandelionOmics

Gene overview

LXL04_004450

Reference: OH-1004 Chr: Chr01 Coordinates: 136472516-136474350 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

790 bp · LXL04_004450|LXL04_004450|OH1004|cDNA

ATGGGTTTCCGGTCTAAATTTCCGCCACCGCTGCCGCCGTCCTCTTCAAAATTGATCACTTTCCTCGTCTGCATCATGCTGTTCCACACATACAACGGTCAAACTCTGCGAACTGATCCTTCCGAAGTAAGAGCGTTAAATACGATATTTGAACGATGGGATGTTCAAATCCCGAGGAACCTATGGAACATAAGCGGAGAACCATGCAGCGGAACAGCACTCGGACCAGATTTCGATGTGGATTACAACAATCCATCCAT...

CDS

Download CDS FASTA

675 bp · LXL04_004450|LXL04_004450|OH1004|CDS

ATGGGTTTCCGGTCTAAATTTCCGCCACCGCTGCCGCCGTCCTCTTCAAAATTGATCACTTTCCTCGTCTGCATCATGCTGTTCCACACATACAACGGTCAAACTCTGCGAACTGATCCTTCCGAAGTAAGAGCGTTAAATACGATATTTGAACGATGGGATGTTCAAATCCCGAGGAACCTATGGAACATAAGCGGAGAACCATGCAGCGGAACAGCACTCGGACCAGATTTCGATGTGGATTACAACAATCCATCCAT...

Protein

Download Protein FASTA

224 aa · LXL04_004450|LXL04_004450|OH1004|PROTEIN

MGFRSKFPPPLPPSSSKLITFLVCIMLFHTYNGQTLRTDPSEVRALNTIFERWDVQIPRNLWNISGEPCSGTALGPDFDVDYNNPSIECNCTFDSNTTCHITKLKVSKLNRQGVIPQELAALTYLAVLKIDQNAFTGTLPPFLGNFSAMVVLSLAHNQFSGTVPKELGNLKQLNMLAISSNNFSGSLPPELGNLVNMQQFYLDSCGAGGEIPPTFANLQNLRVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004450`
TK1151 ID	TkA01G147720
OH-1004 ID	LXL04_004450
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.600
Protein coverage (%)	TK1151 99.083 / OH-1004 46.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004450

Location Chr01:136472516-136474350 (-)

Description Similar to At1g56130: Probable LRR receptor-like serine/threonine-protein kinase At1g56130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At3g14840`	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004450 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G56130

ath:AT1G56140

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785

Rank 1 · LXL04_004450 · OH-1004

Endoplasmic reticulum0.086

Rank 2 · LXL04_004450 · OH-1004

Cytoplasm0.073

Rank 3 · LXL04_004450 · OH-1004

Extracellular0.046

Rank 4 · LXL04_004450 · OH-1004

Lysosome / Vacuole0.038

Rank 5 · LXL04_004450 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14104-179 aa

PF13855.13LRR_8124-183 aa

PF23598.2LRR_14141-222 aa

PF13855.13LRR_8151-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004450	`PF23598.2`	LRR_14	104	179	1.8e-12	47.4
LXL04_004450	`PF13855.13`	LRR_8	124	183	2.1e-08	34.5
LXL04_004450	`PF23598.2`	LRR_14	141	222	1.8e-12	47.4
LXL04_004450	`PF13855.13`	LRR_8	151	205	2.1e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGH2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g56130	46.698%	Swiss-Prot	moderate database homology
`C0LGH3`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g56140	44.076%	Swiss-Prot	moderate database homology
`C0LGN2`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	35.238%	Swiss-Prot	moderate database homology
`Q9ASQ6`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g29720	35.404%	Swiss-Prot	moderate database homology
`C0LGE0`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g07650	29.767%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card