LXL04_004448 | RubberDandelionOmics

Gene overview

LXL04_004448

Reference: OH-1004 Chr: Chr01 Coordinates: 136445930-136447703 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · LXL04_004448|LXL04_004448|OH1004|cDNA

ATGGCTCCATCGAGAAAAATTGCAAGAAAACCAAGAAGAATACTAAAGAAGAAACAGATATCTAGGACTCCTGAAACGAAAGTCGAGAGTACTTCATCTTCGCCAGTAAAGACATGTTCTGATAATTTAAAGAAGATGGACGAGATTAGCAGTATTGGATGTACAACCCCTAAAGCAGAGAAGTATCAGATACCAGAGATTTTAACATGCCCCCCGGCTCCCAAGAAGCGAAGGCTTGCTTCGAGTAGTTGTACATTGAG...

CDS

Download CDS FASTA

501 bp · LXL04_004448|LXL04_004448|OH1004|CDS

ATGGCTCCATCGAGAAAAATTGCAAGAAAACCAAGAAGAATACTAAAGAAGAAACAGATATCTAGGACTCCTGAAACGAAAGTCGAGAGTACTTCATCTTCGCCAGTAAAGACATGTTCTGATAATTTAAAGAAGATGGACGAGATTAGCAGTATTGGATGTACAACCCCTAAAGCAGAGAAGTATCAGATACCAGAGATTTTAACATGCCCCCCGGCTCCCAAGAAGCGAAGGCTTGCTTCGAGTAGTTGTACATTGAG...

Protein

Download Protein FASTA

166 aa · LXL04_004448|LXL04_004448|OH1004|PROTEIN

MAPSRKIARKPRRILKKKQISRTPETKVESTSSSPVKTCSDNLKKMDEISSIGCTTPKAEKYQIPEILTCPPAPKKRRLASSSCTLRRTPISFFDPPDIELFFASHLASIYKHVHTHEVRSWCQVDGICLSMFRPASAMESKKRLCVPTINYYSFLIFFRIWRTHY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004448`
TK1151 ID	TkA01G151350
OH-1004 ID	LXL04_004448
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.300
Protein coverage (%)	TK1151 98.077 / OH-1004 70.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004448

Location Chr01:136445930-136447703 (+)

Description Similar to SMR13: Cyclin-dependent protein kinase inhibitor SMR13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20898`	Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle.	No verified direct reference in this release
`At1g51355`	Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle.	No verified direct reference in this release
`At1g60783`	Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004448 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004860 protein kinase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G51355

ath:AT1G60783

ath:AT3G20898

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.781

Rank 1 · LXL04_004448 · OH-1004

Cytoplasm0.269

Rank 2 · LXL04_004448 · OH-1004

Cell membrane0.072

Rank 3 · LXL04_004448 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_004448 · OH-1004

Plastid0.019

Rank 5 · LXL04_004448 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27568.2SMR_1-1514-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004448	`PF27568.2`	SMR_1-15	14	107	3e-23	82.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IWB3`	Arabidopsis thaliana	Cyclin-dependent protein kinase inhibitor SMR13	45.794%	Swiss-Prot	moderate database homology
`Q3ECS5`	Arabidopsis thaliana	Cyclin-dependent protein kinase inhibitor SMR9	60.714%	Swiss-Prot	weak database homology
`Q1G3Y4`	Arabidopsis thaliana	Cyclin-dependent protein kinase inhibitor SMR15	46.939%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card