Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1965 bp · LXL04_004436|LXL04_004436|OH1004|cDNA
ATGTCATCTCTTGATGTACCCTCACATGTTTCTCTCTCTAGAATTATCTCTCTTTGCTCTCCAGTATCCAGCTTCTCTCAATCTTCTTCGCTCCTCCTTCCAAATTCCTCATCCAGTCTATCTCTTTGTCTATCAGCCGTATCTCTTCACCGCCGCCGTTGTAAAACCACTATCTCATCGTGTAGTCCATCGGAAGGAGAGTTTGAATCAGTAGACGAAGAACTAGCGGGAATTGAAGATGATGTGGAGTCCGATTTCGA...
1965 bp · LXL04_004436|LXL04_004436|OH1004|CDS
ATGTCATCTCTTGATGTACCCTCACATGTTTCTCTCTCTAGAATTATCTCTCTTTGCTCTCCAGTATCCAGCTTCTCTCAATCTTCTTCGCTCCTCCTTCCAAATTCCTCATCCAGTCTATCTCTTTGTCTATCAGCCGTATCTCTTCACCGCCGCCGTTGTAAAACCACTATCTCATCGTGTAGTCCATCGGAAGGAGAGTTTGAATCAGTAGACGAAGAACTAGCGGGAATTGAAGATGATGTGGAGTCCGATTTCGA...
Protein
Download Protein FASTA654 aa · LXL04_004436|LXL04_004436|OH1004|PROTEIN
MSSLDVPSHVSLSRIISLCSPVSSFSQSSSLLLPNSSSSLSLCLSAVSLHRRRCKTTISSCSPSEGEFESVDEELAGIEDDVESDFEDVSDEKLDVDELELEAEKAVREYSLSLSKELKIEEEPVADKETRGRRKMRESIKVVNIPDHLLPKVSIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRAFWGDREFMVIDTGGVLTGSKTQTDVMEQQLSVSTTIGMEGIPLASREAAVARMPSMIERQATVAVEE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004436 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004436 |
|---|---|
| Location | Chr01:136033260-136037757 (-) |
| Description | Similar to der: GTPase Der (Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0042254 ribosome biogenesis Biological Process GO:0005525 GTP binding Molecular Function GO:0043022 ribosome binding Molecular Function |
| KEGG gene cross-reference | ana:alr0483 ava:Ava_2896 npu:Npun_R1702 tel:tlr0878 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01926.30MMR_HSR1152-300 aaPF02421.25FeoB_N152-213 aaPF01926.30MMR_HSR1363-484 aaPF02421.25FeoB_N363-494 aaPF14714.12KH_dom-like543-624 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004436 | PF01926.30 | MMR_HSR1 | 152 | 300 | 1.5e-53 | 180.4 |
| LXL04_004436 | PF02421.25 | FeoB_N | 152 | 213 | 1.4e-18 | 67.6 |
| LXL04_004436 | PF01926.30 | MMR_HSR1 | 363 | 484 | 1.5e-53 | 180.4 |
| LXL04_004436 | PF02421.25 | FeoB_N | 363 | 494 | 1.4e-18 | 67.6 |
| LXL04_004436 | PF14714.12 | KH_dom-like | 543 | 624 | 3.7e-30 | 104.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.