LXL04_004420 | RubberDandelionOmics

Gene overview

LXL04_004420

Reference: OH-1004 Chr: Chr01 Coordinates: 135319771-135322567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · LXL04_004420|LXL04_004420|OH1004|cDNA

ATGAATTCAAACAACTGGCTTTCATTTCCTCTTTCTCCAACCCACTCATCTTTACAATCTCATCTTCAAACCGCTCAATCCCACAATTTTTCTCTAGGCCTTGTTCATGATAACATGGACACCCCCTTTCCTAACCAAGAATGGAACTTGATAGGGGCAGAAGGAAGTAACGATCAAGTCCCTAAAGTCGCTGATTTTTTAGGCGTAAGCAAGTCAGAGAACTCATCAGATCTTGTAGCATATAACGACATCCATGGAAA...

CDS

Download CDS FASTA

1734 bp · LXL04_004420|LXL04_004420|OH1004|CDS

ATGAATTCAAACAACTGGCTTTCATTTCCTCTTTCTCCAACCCACTCATCTTTACAATCTCATCTTCAAACCGCTCAATCCCACAATTTTTCTCTAGGCCTTGTTCATGATAACATGGACACCCCCTTTCCTAACCAAGAATGGAACTTGATAGGGGCAGAAGGAAGTAACGATCAAGTCCCTAAAGTCGCTGATTTTTTAGGCGTAAGCAAGTCAGAGAACTCATCAGATCTTGTAGCATATAACGACATCCATGGAAA...

Protein

Download Protein FASTA

577 aa · LXL04_004420|LXL04_004420|OH1004|PROTEIN

MNSNNWLSFPLSPTHSSLQSHLQTAQSHNFSLGLVHDNMDTPFPNQEWNLIGAEGSNDQVPKVADFLGVSKSENSSDLVAYNDIHGNDTEYMFTNNSLLPQVQNTISATPTTYELPENASTLQSLTLSMGSGKRSTCETSTGDNTSNVTTNASTNSVVEANPRRTLDTFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQVAFDLKNLKPLLDNFNFMGLGGYDKEEKAARAYDMAALKYWGTSTTTNFPIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004420`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004420

Location Chr01:135319771-135322567 (+)

Description Similar to PLT2: AP2-like ethylene-responsive transcription factor PLT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g20840`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g17430`	Transcription factor that, in opposition to HDG1, promotes cell proliferation and morphogenesis via transcriptional activation of meristem and cell proliferation genes, but prevents differentiation, especially during embryogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004420 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007389 pattern specification process Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010449 root meristem growth Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G51190

ath:AT3G20840

ath:AT5G17430

bna:106385624

bna:106426170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_004420 · OH-1004

Cytoplasm0.079

Rank 2 · LXL04_004420 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_004420 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_004420 · OH-1004

Plastid0.014

Rank 5 · LXL04_004420 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2295-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004420	`PF00847.27`	AP2	295	344	1.1e-15	58.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5YGP7`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor PLT2	59.675%	Swiss-Prot	strong database homology
`Q5YGP8`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor PLT1	59.776%	Swiss-Prot	strong database homology
`Q6PQQ4`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor BBM	78.125%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card