LXL04_004415 | RubberDandelionOmics

Gene overview

LXL04_004415

Reference: OH-1004 Chr: Chr01 Coordinates: 135057700-135058905 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1206 bp · LXL04_004415|LXL04_004415|OH1004|cDNA

ATGGCGACGCCATCGTCACCGGAGCTACACCTTTTCAATCTCCGAGCGATTAAAGTTTTAGGTAACGGAGCTATGGGTACAGTCTTCCTTGTTCACAATTTCCTGACTGATCCATCAATCCACTGCCCCTTTGCCCTCAAAGTCGTCGAGAAATGTTGCTCAGAAGCTAAACTGAACACCGACCGCCGTGCCCGTTGGGAGGTTTCCGTTCTCGAACGGTTGAATCGGAATCCCCACCCGTTCCTCCCGTCGTTAATCGG...

CDS

Download CDS FASTA

1206 bp · LXL04_004415|LXL04_004415|OH1004|CDS

ATGGCGACGCCATCGTCACCGGAGCTACACCTTTTCAATCTCCGAGCGATTAAAGTTTTAGGTAACGGAGCTATGGGTACAGTCTTCCTTGTTCACAATTTCCTGACTGATCCATCAATCCACTGCCCCTTTGCCCTCAAAGTCGTCGAGAAATGTTGCTCAGAAGCTAAACTGAACACCGACCGCCGTGCCCGTTGGGAGGTTTCCGTTCTCGAACGGTTGAATCGGAATCCCCACCCGTTCCTCCCGTCGTTAATCGG...

Protein

Download Protein FASTA

401 aa · LXL04_004415|LXL04_004415|OH1004|PROTEIN

MATPSSPELHLFNLRAIKVLGNGAMGTVFLVHNFLTDPSIHCPFALKVVEKCCSEAKLNTDRRARWEVSVLERLNRNPHPFLPSLIGSFETEEILAWAIPFCSGGDLNVLRHRQIDRVFSPAVIRFYLAEIVCALQHLHSMGIVYRDLKPENILIQHSGHVTLTDFDLSRVLAPKSLKSLLLSSEPPDVNNNHWKLPHIFPAKDPEKTNVKLKKAKSARVSPMTRRNPSFSNGERSNSFVGTDEYVAPEVVRGDGHEFAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004415`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004415

Location Chr01:135057700-135058905 (-)

Description Similar to UCNL: Serine/threonine-protein kinase UCNL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20830`	Regulates planar ovule integument development.	No verified direct reference in this release
`At1g51170`	Regulates planar ovule integument development by suppressing aberrantly oriented growth.	No verified direct reference in this release
`At3g25250`	Involved in oxidative burst-mediated signaling.	OXI1 kinase is necessary for oxidative burst-mediated signalling in Arabidopsis.2004 · DOI: 10.1038/nature02353 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At3g12690`	Functions redundantly with AGC1-7 as signaling component in the pollen tube.	Two Arabidopsis AGC kinases are critical for the polarized growth of pollen tubes.2009 · DOI: 10.1111/j.1365-313x.2009.03792.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004415 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0036290 protein trans-autophosphorylation Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0051782 negative regulation of cell division Biological Process

KEGG gene cross-reference

ath:AT1G51170

ath:AT3G12690

ath:AT3G20830

ath:AT3G25250

ath:AT5G47750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · LXL04_004415 · OH-1004

Nucleus0.446

Rank 2 · LXL04_004415 · OH-1004

Mitochondrion0.064

Rank 3 · LXL04_004415 · OH-1004

Cell membrane0.062

Rank 4 · LXL04_004415 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_004415 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr15-175 aa

PF00069.32Pkinase17-180 aa

PF00069.32Pkinase231-336 aa

PF07714.24PK_Tyr_Ser-Thr244-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004415	`PF07714.24`	PK_Tyr_Ser-Thr	15	175	2.4e-22	80.2
LXL04_004415	`PF00069.32`	Pkinase	17	180	5.9e-51	174.1
LXL04_004415	`PF00069.32`	Pkinase	231	336	5.9e-51	174.1
LXL04_004415	`PF07714.24`	PK_Tyr_Ser-Thr	244	324	2.4e-22	80.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT38`	Arabidopsis thaliana	Serine/threonine-protein kinase UCNL	57.711%	Swiss-Prot	strong database homology
`Q9SYB9`	Arabidopsis thaliana	Serine/threonine-protein kinase UCN	58.947%	Swiss-Prot	strong database homology
`Q9LSF1`	Arabidopsis thaliana	Serine/threonine-protein kinase OXI1	42.228%	Swiss-Prot	moderate database homology
`Q39183`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PKL2	39.678%	Swiss-Prot	moderate database homology
`Q9LTW5`	Arabidopsis thaliana	Serine/threonine-protein kinase AGC1-5	41.304%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card